KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03482Help
Entry
TBSG_03482        CDS       T01690                                 

Definition
cholesterol oxidase precursor choD
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:mtk00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3818237..3819973)
Genome map
AA seq 578 aa AA seqDB search
MKPDYDVLIIGSGFGGSVTALRLTEKGYRVGVLEAGRRFSDEEFAKTSWDLRKFLWAPRL
GCYGIQRIHPLRNVMILAGAGVGGGSLNYANTLYVPPEPFFADQQWSHITDWRGELMPHY
QQAQRMLGVVQNPTFTDADRIVKEVADEMGFGDTWVPTPVGVFFGPDGTKTPGKTVPDPY
FGGAGPARTGCLECGCCMTGCRHGAKNTLVKNYLGLAESAGAQVIPMTTVKGFERRSDGL
WEVRTVRTGSWLRRDRRTFTATQLVLAAGTWGTQHLLFKMRDRGRLPGLSKRLGVLTRTN
SESIVGAATLKVNPDLDLTHGVAITSSIHPTADTHIEPVRYGKGSNAMGLLQTLMTDGSG
PQGTDVPRWRQLLQTASQDPRGTIRMLNPRQWSERTVIALVMQHLDNSITTFTKRGKLGI
RWYSSKQGHGEPNPTWIPIGNQVTRRIAAKIDGVAGGTWGELFNIPLTAHFLGGAVIGDD
PEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSIAAQAERAASLWPNKGETDRRPP
QGEPYRRLAPIQPAHPVVPADAPGALRWLPIDPVSNAG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattacgacgtcctgattattggatcgggtttcgggggcagcgtcaccgcg
ctgcggctgacggaaaagggctaccgggtcggcgtgctggaggccggccgccggttctcc
gacgaggagttcgccaagacgtcgtgggacctgcgcaagtttctctgggcgccgaggttg
ggctgctatggcattcaacgtatccacccgctgcgcaacgtgatgatcctggccggcgcc
ggggtgggcgggggctccctcaactacgccaacacgttgtacgtgccgccggagccgttc
ttcgccgaccagcagtggtcacacatcaccgactggcgtggcgagctgatgccgcactac
cagcaggcgcagcggatgctcggggtggtgcaaaacccgaccttcaccgacgccgaccgc
atcgtcaaggaggtcgccgacgagatggggtttggcgacacctgggtgccgaccccggtt
ggagtgttcttcggccccgacggcaccaagacgcccggcaagaccgtgcccgatccctac
ttcggcggtgccgggccggcgcgcaccggctgcctggaatgcggctgctgtatgacgggc
tgtcgccacggtgccaagaacaccctggtgaaaaactaccttggcctcgcggaatcagct
ggcgcgcaagtgattccgatgaccacggtgaaggggtttgagcggcggtccgacgggttg
tgggaggtccgcacagtgcgaaccggcagttggctgcgccgggatcggcgcaccttcacc
gcaacgcagctggtgctggccgcgggcacctgggggacccagcatctgctgttcaagatg
cgggataggggtcggctccctggtctctcgaagcgattgggtgtccttacccgcaccaac
tcagaatcgatcgtcggggccgccaccttgaaggtcaatccggacctggacctgacccac
ggcgtggcgatcacgtcgtcgattcacccgacggccgacacccacatcgaacccgtgcgc
tacggcaaaggctccaacgcgatggggctgctgcagaccttgatgaccgacggctccggt
ccgcagggcaccgatgtgccgcgctggaggcagttgctgcagaccgccagtcaggatccg
cgcggcaccatccggatgctcaatccccggcaatggagcgagcgcaccgtgatcgcgctg
gtcatgcagcacctggacaactcgatcaccacgttcaccaagcgcgggaagctgggtatc
cgctggtactcgagcaagcagggacacggcgagccgaaccctacatggatcccgatcggc
aaccaggtcacccgtcgcatcgccgccaaaatcgacggcgtggccggcggcacctggggt
gagctgttcaacatcccgctcaccgcgcactttctcggcggcgcggtgatcggcgacgac
cccgagcacggcgtcatcgacccctatcaccgggtctatggctatccgacgctgtacgtg
gttgacggtgcggcgatctcggcgaacctgggtgtcaacccgtcgctgtccatcgccgct
caagccgagcgggccgcctcgctgtggccgaacaagggcgaaaccgaccggcggccaccg
cagggtgagccctatcgtcggctggcgccgatccaaccggcgcacccggtggtgcctgcc
gacgccccgggcgcgctgcggtggttgccgatcgatccggtcagcaacgcgggctga

DBGET integrated database retrieval system