KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03667Help
Entry
TBSG_03667        CDS       T01690                                 

Definition
pantoate-beta-alanine ligase panC
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBSG_03667
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TBSG_03667
Enzymes [BR:mtk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase
     TBSG_03667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4026244..4027173)
Genome map
AA seq 309 aa AA seqDB search
MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGS
VVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQP
GPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVA
VVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLD
AAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYR
AILESHWRN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcctgcgttccatcccggtgaactcaatgtgtactcggcaccgggggatgtc
gccgatgtcagtcgcgcactgcgactcaccggccggcgagtgatgttggtgcctactatg
ggtgcgctgcacgaaggccacctcgcgttggtgcgtgcggccaagcgggtgcccggatcg
gtcgtcgtcgtgtcgatcttcgtcaacccgatgcaattcggtgccggggaagatctcgac
gcctatccccgcaccccggacgacgacctggcgcaactgcgggccgaaggcgtggaaatc
gctttcacgccaactaccgcggcgatgtatcccgacggcctgcgcaccaccgtgcaaccc
ggtccgttggccgccgaactcgagggcggcccgcggccaacccatttcgccggcgtgctg
acggtcgtgctaaagctgctgcagatcgtgcgcccggatcgggtgttcttcggtgagaag
gactaccagcagctggtgctgatccggcagctggtcgcggacttcaacctcgatgtcgcg
gtggtcggcgtgccgaccgtgcgcgaagccgacgggctggcgatgtcgtcgcgcaaccgc
tacctggacccggcccagcgtgcggcggccgtcgcgctctcggcggcgctaacggccgca
gcgcatgcggcaacggctggcgcgcaggccgcgctggatgccgcccgtgcggtgctcgac
gctgcacccggcgtggcggtcgactacctggagctgcgcgatatcgggcttggcccgatg
ccgctcaacggttccggtcggctgctggttgctgcccggcttggcaccaccaggctgctg
gacaacattgcgattgaaatcggaactttcgccggcaccgaccgcccggacggataccgg
gcaatcctcgaatcacattggagaaactga

DBGET integrated database retrieval system