KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03762Help
Entry
TBSG_03762        CDS       T01690                                 

Definition
glycerol kinase glpK
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mtk00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4121692..4123245)
Genome map
AA seq 517 aa AA seqDB search
MSDAILGEQLAESSDFIAAIDQGTTSTRCMIFDHHGAEVARHQLEHEQILPRAGWVEHNP
VEIWERTASVLISVLNATNLSPKDIAALGITNQRETTLVWNRHTGRPYYNAIVWQDTRTD
RIASALDRDGRGNLIRRKAGLPPATYFSGGKLQWILENVDGVRAAAENGDALFGTPDTWV
LWNLTGGPRGGVHVTDVTNASRTMLMDLETLDWDDELLSLFSIPRAMLPEIASSAPSEPY
GVTLATGPVGGEVPITGVLGDQHAAMVGQVCLAPGEAKNTYGTGNFLLLNTGETIVRSNN
GLLTTVCYQFGNAKPVYALEGSIAVTGSAVQWLRDQLGIISGAAQSEALARQVPDNGGMY
FVPAFSGLFAPYWRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMEADSGVRL
QVLKVDGGITGNDLCMQIQADVLGVDVVRPVVAETTALGVAYAAGLAVGFWAAPSDLRAN
WREDKRWTPTWDDDERAAGYAGWRKAVQRTLDWVDVS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacgccatcctaggagagcaattggccgagtcctcggatttcatagccgccatc
gaccagggcaccaccagcacccgctgcatgatcttcgatcaccacggtgccgaggtggcc
cgccaccagctcgagcacgagcagatcctgccccgggccggctgggtggagcacaacccg
gtcgagatctgggagcgcaccgcgtcggtgttgatctcggtgctcaacgccaccaaccta
tcgccgaaagatattgccgcgttggggattaccaaccaacgtgagacgacgctggtatgg
aatcggcacaccggacggccctactacaacgcgattgtatggcaggatacccgcaccgac
cgcatcgcgtcggcgctggatcgagacggtcgtggaaacctgatccgccgcaaggcgggc
ctgccgccggcaacttatttctctggcggcaagctgcagtggatcctggaaaatgtcgat
ggagtccgcgcggccgccgagaacggcgacgcattgttcggcacaccggacacctgggtg
ttgtggaatctgaccggcgggccgcgggggggtgtgcatgtcaccgatgtaaccaacgcc
agccggaccatgttgatggatctagagacgctggactgggacgacgagctgttgtcgttg
ttttcgatacctcgggccatgctgcccgagatcgcatcgtcggcgccgtcggagccttac
ggtgtcacgctggcgaccgggcctgtcggcggtgaggtgccgatcaccggagttctcggt
gatcagcatgcggccatggtcggtcaagtctgtctggccccaggggaggcgaaaaacacc
tatgggaccggcaattttctgctgctgaacaccggtgaaacgatcgtgcgatcgaataac
ggcctgctaaccacggtgtgctaccaattcgggaacgctaaacccgtgtacgcgcttgaa
ggttcgatcgcggtgaccggctcggcggtgcagtggctacgcgatcagctgggcatcatc
agcggcgccgcacagagtgaggcgctggcccgccaggtccccgacaacggcggcatgtat
ttcgtgccggcgttttccgggctgttcgcgccatactggcggtccgatgcgcgcggcgcg
atcgtcgggttgtcgcggttcaacaccaacgcgcacctggcgcgcgcaacgctggaggcg
atctgctaccagagccgcgatgtggtggacgccatggaagcagactccggtgttcgcctg
caggtgttgaaggtggatggcgggatcaccggcaacgacctgtgtatgcagatccaggcc
gacgtgttgggtgtggatgtggtgcggccggtggtcgccgagaccaccgcactaggtgtg
gcctacgcggcgggcttggcggtcgggttctgggcggctccgtccgatctgcgggccaac
tggcgagaggacaagcggtggacaccgacgtgggacgacgacgagcgtgccgcgggttat
gccggctggcgcaaggcggtgcagcggaccctggattgggttgacgtgtcctag

DBGET integrated database retrieval system