KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03778Help
Entry
TBSG_03778        CDS       T01690                                 

Definition
2-isopropylmalate synthase
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:mtk01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtk01230]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mtk00620]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:mtk00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4137230..4139164
Genome map
AA seq 644 aa AA seqDB search
MTTSESPDAYTESFGAHTIVKPAGPPRVGQPSWNPQRASSMPVNRYRPFAEEVEPIRLRN
RTWPDRVIDRAPLWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKEIEVGFPSASQT
DFDFVREIIEQGAIPDDVTIQVLTQCRPELIERTFQACSGAPRAIVHFYNSTSILQRRVV
FRANRAEVQAIATDGARKCVEQAAKYPGTQWRFEYSPESYTGTELEYAKQVCDAVGEVIA
PTPERPIIFNLPATVEMTTPNVYADSIEWMSRNLANRESVILSLHPHNDRGTAVAAAELG
FAAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQIDFSNIDEIRRTVEYCNQLPV
HERHPYGGDLVYTAFSGSHQDAINKGLDAMKLDADAADCDVDDMLWQVPYLPIDPRDVGR
TYEAVIRVNSQSGKGGVAYIMKTDHGLSLPRRLQIEFSQVIQKIAEGTAGEGGEVSPKEM
WDAFAEEYLAPVRPLERIRQHVDAADDDGGTTSITATVKINGVETEISGSGNGPLAAFVH
ALADVGFDVAVLDYYEHAMSAGDDAQAAAYVEASVTIASPAQPGEAGRHASDPVTIASPA
QPGEAGRHASDPVTSKTVWGVGIAPSITTASLRAVVSAVNRAAR
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacttctgaatcgcccgacgcctataccgagtcgtttggggcccacaccatcgtg
aaacccgccggcccacctcgcgtcggtcagccctcgtggaatccgcagcgagcctcgtcg
atgccggtcaaccgctaccggccgttcgccgaggaggtcgagcccatccggctgagaaac
cgcacgtggcctgatcgcgtcatcgatcgtgcgccgctgtggtgcgcggtcgacttacgc
gatggcaaccaggcgctgatcgacccgatgagcccggcccgcaagcgccgcatgttcgac
ctgctggtccggatgggctacaaggagattgaggtggggttcccctcggccagccagacc
gacttcgacttcgtcagagagatcatcgagcagggcgccattcccgacgacgtcaccatc
caggtgctcacccaatgccgtcccgagctgatcgagcgcaccttccaggcgtgttcgggc
gcaccccgggccatcgtgcacttctacaactcgacgtcaatcctgcagcgccgcgtggtc
tttcgcgccaaccgggctgaggtgcaggccatcgcgacagatggggcgcgcaagtgcgtc
gagcaggccgccaaatacccgggcacgcagtggcgattcgagtactccccggagtcctac
accggcaccgaactggaatacgccaaacaggtgtgcgacgccgtcggcgaggtcattgcg
ccgacgccggagcgcccgatcatcttcaacctgcccgccacggtggagatgacgacgccc
aatgtctacgccgactcgatcgagtggatgagccgcaacctagccaaccgggagtcggtc
atcctgagcctgcacccgcacaatgaccgcggaaccgccgtcgccgcagcggaattgggt
ttcgcggccggggctgatcggatcgagggctgcctgttcggcaacggcgagcgcaccggc
aacgtgtgcctggtcacgctgggactcaacctgttctcccgaggtgtggacccgcagatc
gacttctccaatattgacgagatccggcgcacggtggagtactgcaaccagctgccggtg
cacgaacgtcacccctatggcggcgacctggtgtacaccgcgttctccggtagccaccag
gacgccatcaacaagggcctagacgcgatgaagctggatgcggatgccgccgactgtgac
gtcgacgacatgctgtggcaggtgccgtatctgcccatcgacccgcgcgatgtcgggcgc
acctacgaggcggtgatccgggtcaactcgcagtccggcaagggcggcgtggcctacatc
atgaagaccgaccacggcctttccctgccgcggcggctgcagatcgagttttcccaggta
atccagaagatcgcagagggtacagcaggcgagggtggcgaggtctcgcccaaggagatg
tgggatgcgttcgccgaggagtatctggccccggtgcggcctttggagcggataaggcaa
catgtggacgctgccgacgacgacggcggcacgaccagcatcacggcgaccgtcaagatc
aacggcgtggagaccgagatcagcgggtccggtaacggtccgttggccgcgttcgtccat
gcgctggccgatgtcgggtttgacgtggccgtgctggactactacgagcacgcgatgagc
gccggcgacgacgctcaggccgccgcgtatgtggaggcctccgtgacgatcgcgagcccg
gcgcagccgggcgaagcgggtcggcacgcatcggaccccgtgacgatcgcgagcccggcg
cagccgggcgaagcgggtcggcacgcatcggaccccgtgacgagtaagacggtgtggggt
gtcggtatcgcaccgtcaatcaccaccgcgtcgctgcgcgccgtggtgtcggcggtcaac
cgggcggcacgctag

DBGET integrated database retrieval system