KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03778Help
Entry
TBSG_03778        CDS       T01690                                 

Definition
2-isopropylmalate synthase
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    TBSG_03778
   01230 Biosynthesis of amino acids
    TBSG_03778
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBSG_03778
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    TBSG_03778
Enzymes [BR:mtk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     TBSG_03778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4137230..4139164
Genome map
AA seq 644 aa AA seqDB search
MTTSESPDAYTESFGAHTIVKPAGPPRVGQPSWNPQRASSMPVNRYRPFAEEVEPIRLRN
RTWPDRVIDRAPLWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKEIEVGFPSASQT
DFDFVREIIEQGAIPDDVTIQVLTQCRPELIERTFQACSGAPRAIVHFYNSTSILQRRVV
FRANRAEVQAIATDGARKCVEQAAKYPGTQWRFEYSPESYTGTELEYAKQVCDAVGEVIA
PTPERPIIFNLPATVEMTTPNVYADSIEWMSRNLANRESVILSLHPHNDRGTAVAAAELG
FAAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQIDFSNIDEIRRTVEYCNQLPV
HERHPYGGDLVYTAFSGSHQDAINKGLDAMKLDADAADCDVDDMLWQVPYLPIDPRDVGR
TYEAVIRVNSQSGKGGVAYIMKTDHGLSLPRRLQIEFSQVIQKIAEGTAGEGGEVSPKEM
WDAFAEEYLAPVRPLERIRQHVDAADDDGGTTSITATVKINGVETEISGSGNGPLAAFVH
ALADVGFDVAVLDYYEHAMSAGDDAQAAAYVEASVTIASPAQPGEAGRHASDPVTIASPA
QPGEAGRHASDPVTSKTVWGVGIAPSITTASLRAVVSAVNRAAR
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacttctgaatcgcccgacgcctataccgagtcgtttggggcccacaccatcgtg
aaacccgccggcccacctcgcgtcggtcagccctcgtggaatccgcagcgagcctcgtcg
atgccggtcaaccgctaccggccgttcgccgaggaggtcgagcccatccggctgagaaac
cgcacgtggcctgatcgcgtcatcgatcgtgcgccgctgtggtgcgcggtcgacttacgc
gatggcaaccaggcgctgatcgacccgatgagcccggcccgcaagcgccgcatgttcgac
ctgctggtccggatgggctacaaggagattgaggtggggttcccctcggccagccagacc
gacttcgacttcgtcagagagatcatcgagcagggcgccattcccgacgacgtcaccatc
caggtgctcacccaatgccgtcccgagctgatcgagcgcaccttccaggcgtgttcgggc
gcaccccgggccatcgtgcacttctacaactcgacgtcaatcctgcagcgccgcgtggtc
tttcgcgccaaccgggctgaggtgcaggccatcgcgacagatggggcgcgcaagtgcgtc
gagcaggccgccaaatacccgggcacgcagtggcgattcgagtactccccggagtcctac
accggcaccgaactggaatacgccaaacaggtgtgcgacgccgtcggcgaggtcattgcg
ccgacgccggagcgcccgatcatcttcaacctgcccgccacggtggagatgacgacgccc
aatgtctacgccgactcgatcgagtggatgagccgcaacctagccaaccgggagtcggtc
atcctgagcctgcacccgcacaatgaccgcggaaccgccgtcgccgcagcggaattgggt
ttcgcggccggggctgatcggatcgagggctgcctgttcggcaacggcgagcgcaccggc
aacgtgtgcctggtcacgctgggactcaacctgttctcccgaggtgtggacccgcagatc
gacttctccaatattgacgagatccggcgcacggtggagtactgcaaccagctgccggtg
cacgaacgtcacccctatggcggcgacctggtgtacaccgcgttctccggtagccaccag
gacgccatcaacaagggcctagacgcgatgaagctggatgcggatgccgccgactgtgac
gtcgacgacatgctgtggcaggtgccgtatctgcccatcgacccgcgcgatgtcgggcgc
acctacgaggcggtgatccgggtcaactcgcagtccggcaagggcggcgtggcctacatc
atgaagaccgaccacggcctttccctgccgcggcggctgcagatcgagttttcccaggta
atccagaagatcgcagagggtacagcaggcgagggtggcgaggtctcgcccaaggagatg
tgggatgcgttcgccgaggagtatctggccccggtgcggcctttggagcggataaggcaa
catgtggacgctgccgacgacgacggcggcacgaccagcatcacggcgaccgtcaagatc
aacggcgtggagaccgagatcagcgggtccggtaacggtccgttggccgcgttcgtccat
gcgctggccgatgtcgggtttgacgtggccgtgctggactactacgagcacgcgatgagc
gccggcgacgacgctcaggccgccgcgtatgtggaggcctccgtgacgatcgcgagcccg
gcgcagccgggcgaagcgggtcggcacgcatcggaccccgtgacgatcgcgagcccggcg
cagccgggcgaagcgggtcggcacgcatcggaccccgtgacgagtaagacggtgtggggt
gtcggtatcgcaccgtcaatcaccaccgcgtcgctgcgcgccgtggtgtcggcggtcaac
cgggcggcacgctag

DBGET integrated database retrieval system