KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03783Help
Entry
TBSG_03783        CDS       T01690                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mtk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4143438..4144049)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCG
NVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQ
LRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRVLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagggacccgtccaggacctgattgacgaactcggcaagttgccggggatcgga
cccaagagtgcgcagcgaatcgccttccacctgttgtcggtagaaccgtcggacatcgac
cggctgaccggtgtgctggcgaaggttcgggacggcgtgcgattctgcgcggtgtgtggg
aatgtctctgacaacgagcgttgcagaatctgctctgatatccgtcgcgatgcgtccgtg
gtgtgcattgtcgaggaacccaaagacatccaggccgtcgagcgcacccgcgagttccgg
ggtcgctatcacgtcctgggcggggcgcttgacccgctgtccggaattgggccggatcag
ctgcggatccgcgaactgctgagccgcatcggggaacgggtcgacgacgtcgacgtcacc
gaggtcatcatcgccaccgaccccaacaccgagggcgaggcgacggccacctacctggtg
cgaatgctgcgcgacatccccggcctgaccgtcacacggatcgcgtccgggctgccgatg
ggcggtgacctggaattcgccgacgagctcaccctgggccgagcgctcgccggccgccgc
gtgctcgcctga

DBGET integrated database retrieval system