KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03842Help
Entry
TBSG_03842        CDS       T01690                                 

Definition
(GenBank) histidinol-phosphate aminotransferase hisC2
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00340  Histidine metabolism
mtk00350  Tyrosine metabolism
mtk00360  Phenylalanine metabolism
mtk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtk00401  Novobiocin biosynthesis
mtk01100  Metabolic pathways
mtk01110  Biosynthesis of secondary metabolites
mtk01130  Biosynthesis of antibiotics
mtk01230  Biosynthesis of amino acids
Module
mtk_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    TBSG_03842
   00350 Tyrosine metabolism
    TBSG_03842
   00360 Phenylalanine metabolism
    TBSG_03842
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TBSG_03842
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    TBSG_03842
Enzymes [BR:mtk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     TBSG_03842
Amino acid related enzymes [BR:mtk01007]
 Aminotransferase (transaminase)
  Class II
   TBSG_03842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Alliinase_C
Motif
Other DBs
NCBI-ProteinID: AEB05971
Structure
PDB: 

Jmol
Position
4200683..4201744
Genome map
AA seq 353 aa AA seqDB search
MTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCV
QLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVA
GAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHIL
IAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALD
KVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVW
LPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWRSDQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccgcctgcgacccgagctggctgggctgccggtttatgtgcccggcaaaacg
gtgccgggcgccatcaagctggccagcaacgaaaccgtgttcggcccgctgcccagcgtc
cgtgccgccatcgaccgggctaccgacacggtcaaccgctaccccgacaacggctgcgtg
cagctcaaggccgcgctggcccggcatcttggcccggacttcgctcccgagcacgtcgcc
gtcggttgcggctcggtcagcctctgccagcaactcgttcaggtcaccgcctcggttggt
gacgaagtggtcttcggctggcgcagctttgagctctatccaccacaggtccgggtcgcc
ggcgctatccccatccaggtgccgttgaccgaccacacgttcgacctctacgccatgctc
gccacggtcaccgaccgcacccggctgatcttcgtgtgcaaccccaacaatccgacctcc
accgtcgtcggtccggacgcgctggcccgcttcgtcgaggcggttccggcgcacatcctg
atcgccatcgacgaggcgtatgtggagtacatccgggacggcatgcggcccgacagctta
ggcctggttcgcgcacacaacaatgtcgttgtgctgcgtacgttttcgaaagcgtacggc
ctggcggggttgcggatcggctacgcgatcggccaccccgacgtcataaccgcgctggac
aaggtctacgtgccatttaccgtgtcgagtatcgggcaggccgcggccatcgcgtccctg
gacgccgccgacgagctgctggcccgtaccgacaccgtggttgccgagcgcgcccgcgtc
agcgccgagttgcgtgctgccgggttcacgctgccgccatcgcaggccaactttgtctgg
cttccgctgggatcccgcacccaagacttcgtggagcaggccgccgatgcacgcatcgtg
gtccgcccgtacggcacggatggcgttcgggtcaccgtcgccgcaccagaggagaacgac
gcgttcctgcggttcgcccgccgctggcggagcgaccaatga

DBGET integrated database retrieval system