KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0056Help
Entry
CCDC5180_0056     CDS       T01992                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCDC5180_0056
Enzymes [BR:mtl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CCDC5180_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
67284..68207
Genome map
AA seq 307 aa AA seqDB search
MRVVRAPALILVDAANPLAGKPFYVDPASAAMVAARNANPPNAELTSVANTPQSYWLDQA
FPPATVGGTVARYTGAAQAAGAMPVLTLYGIPHRDCGSYASGGFATGTDYRGWIDAVASG
LGSSPATIIVEPDALAMADCLSPDQRQERFDLVRYAVDTLTRDPAAAVYVDAGHSRWLSA
EAMAARLNDVGVGRARGFSLNVSNFYTTDEEIGYGEAISGLTNGSHYVIDTSRNGAGPAP
DAPLNWCNPSGRALGAPPTTATAGAHADAYLWIKRPGESDGTCGRGEPQAGRFVSQYAID
LAHNAGQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggtcgttcgggccccggcgttgatcctggtcgatgcggcaaacccgctggccgga
aagcccttctacgtcgatcccgcctcggcggccatggtcgccgcgcgcaacgccaacccg
ccgaacgccgagctgacctccgtcgccaacaccccgcagtcctactggctcgaccaggca
ttcccgccggcgaccgtcggcggcacggttgccaggtacaccggagcggcgcaggcggcc
ggcgccatgccggttctgacgctgtatggaatcccccatcgcgactgcggtagctacgca
tccggtgggttcgcgacgggcactgattaccgcgggtggatcgacgctgtcgcatccggc
ctgggctcatcgccggcgacgatcatcgtcgaacccgatgcgctggccatggccgactgc
ctgtcgcctgaccagcgccaggaacgtttcgacttggtgcgctacgccgtcgacacgctg
acccgcgacccggccgctgccgtgtacgtcgatgcggggcattcgcgctggctgagcgcc
gaggcaatggccgccaggctcaacgatgtcggtgtgggccgcgcgcgcgggtttagcctc
aacgtctcgaacttctacaccaccgatgaggaaatcggctatggcgaggcgatttcgggg
ctcacgaacggttcgcattacgtgatcgacacgtcgcgcaacggcgccggacccgcgccc
gacgccccgctcaactggtgtaaccccagcggccgcgccctgggcgcaccgcccaccacg
gcgaccgcgggcgcgcacgccgacgcttacctgtggatcaaacgtcccggggaatcggac
ggaacctgcggtcgcggggagcctcaggcgggtcggttcgttagccagtacgccatcgat
ctggcccacaacgccggccagtag

DBGET integrated database retrieval system