KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0451Help
Entry
CCDC5180_0451     CDS       T01992                                 

Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCDC5180_0451
   01230 Biosynthesis of amino acids
    CCDC5180_0451
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCDC5180_0451
  Energy metabolism
   00680 Methane metabolism
    CCDC5180_0451
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCDC5180_0451
Enzymes [BR:mtl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CCDC5180_0451
Exosome [BR:mtl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CCDC5180_0451
  Exosomal proteins of melanoma cells
   CCDC5180_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
574104..574874
Genome map
AA seq 256 aa AA seqDB search
MRERLAGMANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLP
DVLYTSLLRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQF
MAWRRSYDTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLR
VGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDP
EAAAAGAAAVAGQGRG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagagacttgccggtatggcaaacactggcagcctggtgttgctgcgccacggc
gagagcgactggaatgccctcaacctgttcaccggctgggtcgatgtcggcctgacggac
aagggccaggcagaggcggttcgaagcggcgagctgatcgcggaacacgacctattgccc
gacgtgctctacacctcgttgctgcggcgcgcgatcaccaccgcgcatctggcgttggac
agcgccgatcggctctggattcccgtgcggcgtagctggcggctcaacgaacgccactac
ggcgcgctgcagggtttggacaaggccgagaccaaggcccgctatggcgaagagcagttc
atggcctggcggcgcagctatgacacgccgccgccgccgatcgagcggggcagtcagttc
agccaggacgccgaccctcgttacgccgacatcggcggtggcccgctcaccgaatgtctg
gctgacgtggtcgcccggtttttgccatatttcaccgacgtcatcgttggcgacttgcgg
gtcggcaagacggtgctgatcgttgcccacggcaactcgttgcgcgcgctggtcaagcac
ctggaccagatgtctgacgacgaaatcgtcggactgaacatcccgaccggaattccgctg
cgctacgacctggattccgcgatgaggccgctggtgcgcggtggtacgtatctggacccg
gaggcggcagccgccggcgccgccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system