KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0474Help
Entry
CCDC5180_0474     CDS       T01992                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCDC5180_0474
Enzymes [BR:mtl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CCDC5180_0474
Exosome [BR:mtl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCDC5180_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
600379..601266
Genome map
AA seq 295 aa AA seqDB search
MLPMFVADGIDEPRPITSMPGVVQHTRDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVG
SAGIDPDGILNVALRDLAKDLGEATVLMADTCLDEFTDHGHCGVLDDRGRVDNDATVARY
VELAVAQAESGAHVVGPSGMMDGQVAAIRDGLDAAGYIDVVILAYAAKFASAFYGPFREA
VSSSLSGDRRTYQQEPGNAAEALREIELDLDEGADIVMVKPAMGYLDVVAAAADVSPVPV
AAYQVSGEYAMIRAAAANNWIDERAAVLESLTGIRRAGADIVLTYWAVDAAGWLT
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgctgccgatgttcgttgccgacggcattgacgagccgcggccgattacctccatgccg
ggcgtggtacagcacacccgggattcgctacgtagggccgcggcagccgcggtggccgcc
ggcgtgggtgggctgatgcttttcggcgtgccgcgcgaccaggacaaggacggtgtcggt
tcggcgggcatcgaccccgacgggatcctcaacgtcgcccttcgcgatctggccaaggac
ctgggtgaggccacggtgttgatggccgacacctgtctggacgagttcaccgaccacggg
cactgcggtgtgctcgatgaccggggccgggtcgataacgacgccaccgtggcccgctat
gtggaactggctgtggcgcaagcggaatcgggcgcccacgtggtcggacccagtgggatg
atggatggccaggtagccgcgatccgagacggtttggacgccgccggctacatcgatgtg
gtgatcttggcctacgccgcgaagtttgcttcggcgttctacggcccgttccgcgaggcg
gtgagctctagcctgtccggggatcggcgcacctaccagcaggagccgggcaacgccgcc
gaggcgctgcgtgagatcgagctcgatctcgacgaaggcgccgacattgtgatggtcaaa
cccgcgatgggctacctcgatgtggtggcggccgcggcggacgtctcgccggtcccggtg
gccgcctatcaggtctcgggagagtacgcgatgattcgtgcggcggcggccaataattgg
atcgatgagcgtgccgcggtgctagagtcgctgaccggtatccggcgtgccggcgccgac
atcgtgctcacctactgggcggtagacgcggcgggctggcttacgtga

DBGET integrated database retrieval system