KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0600Help
Entry
CCDC5180_0600     CDS       T01992                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:mtl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mtl00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mtl00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mtl00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mtl00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:mtl00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743295..744203
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKIAAGLADPAGTLVHTAQRPTPAYGGAEQVWAAVAEMIADALGVAGGAV
GGVGIASAGPIDLHSGRVSPITIGSWGGFPLRDRVAAAVPGVPVRLGGDGVCMALGEHWL
GAGRGARFLLGLVVSTGVGGGLVLDGAPCLGRTGNAGHVGHVVVDPDGSPCPCGGRGCVE
TIASGPSLARWARANGWSAPPGAGAKELAEAAGAGDPVALRAFRRGAAALAAMIASVGAV
CDLDLAVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRVVPAELGGAAGLVGAARLAA
IA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctttgcctcgacatcggcggcaccaagatcgccgcgggcctggccgacccg
gccggcacgttggtgcacaccgcccaacgtcccaccccggcgtatggcggagccgaacag
gtctgggccgcggtcgccgagatgatcgccgacgcgctcggcgtggcggggggcgcggtc
ggtggtgtggggatcgcctcggccggtcctatcgacctacacagcggccgcgtcagcccg
atcaccatcggatcctggggcggctttccgctgcgggatcgggtcgccgccgcggtcccg
ggggttccggtgcggctggggggtgacggggtgtgcatggcgctcggcgagcactggctg
ggagccggacggggtgcgcgctttctgttgggtttggtggtgtccaccggggtgggcggc
gggttggtgctcgacggcgccccctgtctcggccgcaccggcaacgccggtcacgtcggc
cacgtggtggtggatccggatggctcgccgtgcccgtgcggggggcgtggctgtgtggag
accatcgcgtccggcccgtcgctggcgcgctgggcgcgggccaacgggtggtccgcgccg
cccggggccggcgccaaagagctggccgaggcggctggggccggagacccggtggcgctg
cgggccttccgccgcggcgccgcggcgctggccgcgatgatcgcctcggtgggcgccgtg
tgcgacttggatctcgccgtcatcggcggcggcgtggccaagtcgggtcgcctgctgttc
gagccgttacgtgcggcgctagccgaccacgcccggctggactttctggccggcctgcgg
gtggtgcctgccgagctgggcggcgccgccggcctggtgggtgcggccaggctcgcggcc
atcgcataa

DBGET integrated database retrieval system