KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0616Help
Entry
CCDC5180_0616     CDS       T01992                                 

Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CCDC5180_0616
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5180_0616
   00650 Butanoate metabolism
    CCDC5180_0616
  Lipid metabolism
   00071 Fatty acid degradation
    CCDC5180_0616
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5180_0616
   00310 Lysine degradation
    CCDC5180_0616
   00360 Phenylalanine metabolism
    CCDC5180_0616
   00380 Tryptophan metabolism
    CCDC5180_0616
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5180_0616
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5180_0616
   00281 Geraniol degradation
    CCDC5180_0616
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5180_0616
   00627 Aminobenzoate degradation
    CCDC5180_0616
   00930 Caprolactam degradation
    CCDC5180_0616
Enzymes [BR:mtl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5180_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769381..770319
Genome map
AA seq 312 aa AA seqDB search
MTHAIRPVDFDNLKTMTYEVTGRIARITFNRPEKGNAIIADTPLELSALVERADLDPGVH
VILVSGRGEGFCAGFDLSAYAEGSSSTGGGGAYQGTVLDGKTQAVNHLPNQPWDPMIDYQ
MMSRLVRGFASLMHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPEPADLDERTERLVARIAALPV
NQLIMVKLALNSALLQQGVATSRMVSTVFDGAARHTPEGHAFVADAVEHGFRDAVRRRDE
PFGDYGRQASRV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcgatcaggccggtcgatttcgacaacctgaagacgatgacctatgaggtc
accggtcggattgcgcggatcaccttcaaccggccggagaagggcaacgcgatcatcgca
gacaccccgctggagttgtctgctctggtggagcgtgccgatctggatccaggcgtgcat
gtcattctggtgtccggtcgcggcgagggattctgtgccggcttcgacctgtccgcctac
gccgaggggtcgtcgtcgaccgggggcggcggcgcataccaaggcacggtgctagatggc
aagacccaggccgtcaaccacctaccgaaccagccgtgggacccgatgatcgactaccag
atgatgagccggttagtgcgcggattcgccagtctgatgcatgccgacaagccgacggtg
gtcaagatccacggctactgcgtggccggcggcaccgacatcgcgctgcacgccgatcag
gtgatcgccgccgccgacgccaagatcggctacccgcccacccgggtgtggggggtgccg
gcggcgggcctgtgggcgcaccggctcggcgaccagcgggccaaacggctgctgttcacc
ggcgattgcatcaccggcgcgcaggccgccgagtggggcctggcggtcgaggcgccggag
ccggctgacctcgacgagcggaccgagcgactggtggcccggatcgccgcactgccggtc
aatcaattgatcatggtcaagctcgcgctcaattccgctctgctgcaacagggtgtggcc
accagcaggatggtcagcaccgtgttcgacggcgccgctcggcacacacccgaggggcac
gcgtttgtcgccgacgcggtcgagcacggcttccgggatgcggtgcggcgccgtgacgag
ccgtttggcgactacggccgtcaagcatcgcgggtgtaa

DBGET integrated database retrieval system