KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0664Help
Entry
CCDC5180_0664     CDS       T01992                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mtl00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(816209..816865)
Genome map
AA seq 218 aa AA seqDB search
MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLV
DAGGAVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEF
AIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANHGLVAVGPRPDQVLRVTALVE
RTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANPL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgttgacgacccggaatccgcggtgctggcggccgccaaggacatgttgcgt
cggggcctggtcgaggggaccgccggaaatatctcagccaggcgctcggacggcaacgtg
gtcatcacgccgtcctcggtcgactacgccgagatgctgctccacgatctggtgctagtc
gacgccggcggtgcggtgctgcacgccaaggacggccggtcgccgtcgaccgaactaaac
ctacacctggcgtgctatcgcgcattcgacgacattggcagcgtgatccacagccacccg
gtgtgggcgaccatgttcgccgtcgcccatgagccgattcccgcctgcatcgacgagttc
gcgatctactgcggcggggacgttcgctgcaccgagtacgccgcgtccggtacacccgag
gtcggccgcaacgcggtgcgcgcgcttgagggccgcgccgccgccctgatcgccaaccac
ggcctggtggccgtggggccccgccccgaccaggtgctgcgcgtcaccgcccttgttgag
cgcaccgcacaaatcgtttggggtgcccgcgctctcggtggaccggtgccaattcctgag
gacgtgtgccgtaacttcacgggcgtctacggctatctgcgcgcgaatccgctctag

DBGET integrated database retrieval system