KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0863Help
Entry
CCDC5180_0863     CDS       T01992                                 

Definition
hypothetical formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CCDC5180_0863
Enzymes [BR:mtl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CCDC5180_0863
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CCDC5180_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049917..1050399
Genome map
AA seq 160 aa AA seqDB search
MLVAGTPQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSDEILHVA
KISPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHARTGLPC
PVCGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtggccgggacgccgcagccgcgcgcgctcgggcccgatgcgctggacgtcagc
accgacgacctggccgggctgttggccggcaacaccggccggatcaagaccgtcatcacc
gaccagaaggtaattgccggcatcggcaacgcctatagtgacgaaatcctgcacgtcgcg
aagatctcgccgttcgccacggccggcaagttatccggcgcacagctcacctgcctgcat
gaggcgatggcgtcggtgctgtcggacgcggtgcgccggtccgtcggccagggcgcggcc
atgctcaaaggggagaaacgttctgggcttcgagtacatgcgcgcaccgggttaccctgc
ccagtgtgcggtgacaccgtgcgggaggtgtccttcgcggacaagtcttttcagtactgt
ccaacgtgtcagaccggtggcaaggcgctggccgaccggcgtatgtcgcggctgctcaag
tag

DBGET integrated database retrieval system