KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0875Help
Entry
CCDC5180_0875     CDS       T01992                                 

Definition
(GenBank) hypothetical protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00860  Porphyrin and chlorophyll metabolism
mtl01100  Metabolic pathways
mtl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCDC5180_0875
Enzymes [BR:mtl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CCDC5180_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_3 AAA_PrkA AAA_16 MCM ABC_tran NACHT DLIC
Motif
Other DBs
NCBI-ProteinID: AEJ49712
Position
1066068..1067420
Genome map
AA seq 450 aa AA seqDB search
MGELRAAGHRERGVKQEIRENLLTALADGDNVWPGILGFDDTVIPQVERALIAGHDFVLL
GERGQGKTRLLRALAGLLDEWTPVIAGAELGEHPYTPITPESIRRAAQLGDDLPVAWKHR
SERYTEKLATPDTSVADLVGDVDPIKVAEGRSLGDPETIAYGLIPRAHRGIVAVNELPDL
AERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPIKDRFGAEIR
THYPLELEAEMGVIVQEAHLSAQVPDYLMQVLARFARYLRESRSIDQRSGVSARFAIAAA
ETVAAAARHRGAVLGETDPVARVVDLGTVIDVLRGKLEFESGEEGREQAVLEHLLRRATA
DTASRVLGGIDVGSLVTAVEGGSAVTTGERVSAKDVLAAVPGLPVVDRIARKLGAESEGE
RAAALELALEALYLAKRVDKVCGEGQTVYG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgagctgcgtgccgccggtcatcgggaacggggggtcaagcaggaaatccgggaa
aatctgctgaccgcgctggccgacggcgacaacgtctggccgggcatcctgggtttcgac
gacaccgtgattccccaggtggagcgggccttgatcgccggtcacgactttgtcctgctc
ggcgaacgcggccagggcaagacccggctgctgcgcgcactcgcgggtctgctggacgag
tggacgccggtgatcgccggcgccgaactgggcgagcacccctacacgccgatcacgccg
gagtcgatccggcgggccgcgcagctcggcgacgacctaccggtggcgtggaagcaccgc
agcgagcgctacaccgagaagctggccacccccgacaccagcgtcgccgacctggtcggc
gacgtcgacccgatcaaggttgccgagggccgcagcctcggggatcccgaaaccatcgcc
tacgggctcatcccgcgggcgcaccgcggcatcgtcgcggtcaacgagctgcccgacctc
gccgaacgcatccaggtgtcgatgctcaacgtcatggaggagcgcgacatccaggtccgc
ggctacacgctgcggctgccgctggatgtgttggtggtcgccagcgccaaccccgaggac
tacaccaaccgtggccgcatcatcacgcccatcaaggaccggttcggcgccgagatccgc
acccactacccactggagctggaggcggagatgggcgtcatcgtccaggaggcgcacctg
agtgcacaggtgcccgactacctgatgcaggtgctcgcgcggtttgcccgttacctgcga
gaatcccgctcgatcgatcagcgctccggggtgtcggcgcggtttgccatcgcagcggcc
gaaaccgtggcggctgccgcccggcaccgcggggcggtgctgggggagacagacccggtg
gcccgggtggtcgatttgggcacggtgatcgacgtgctgcgcggcaagctggaattcgag
tccggcgaggagggccgcgaacaggcggtgctcgagcatctgttgcgtcgcgccaccgcc
gataccgcgtcccgggtgctgggcggtatcgacgttggctcgttggtgaccgcggtcgag
ggcggttcggcggtgacgacgggcgagcgggtctcggccaaggatgtgctggcggcggtg
ccgggcctgccggtggtggacaggatcgcgcgcaagctgggcgccgaatccgagggggag
cgtgccgcggcactggaactggcgttggaggcgctatacctggccaagcgcgttgacaag
gtctgcggggagggccagaccgtctatggctaa

DBGET integrated database retrieval system