KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0981Help
Entry
CCDC5180_0981     CDS       T01992                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00071  Fatty acid degradation
mtl00280  Valine, leucine and isoleucine degradation
mtl00281  Geraniol degradation
mtl00310  Lysine degradation
mtl00360  Phenylalanine metabolism
mtl00362  Benzoate degradation
mtl00380  Tryptophan metabolism
mtl00410  beta-Alanine metabolism
mtl00627  Aminobenzoate degradation
mtl00640  Propanoate metabolism
mtl00650  Butanoate metabolism
mtl00903  Limonene and pinene degradation
mtl00930  Caprolactam degradation
mtl01100  Metabolic pathways
mtl01110  Biosynthesis of secondary metabolites
mtl01120  Microbial metabolism in diverse environments
mtl01130  Biosynthesis of antibiotics
mtl01212  Fatty acid metabolism
Module
mtl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5180_0981
   00650 Butanoate metabolism
    CCDC5180_0981
  Lipid metabolism
   00071 Fatty acid degradation
    CCDC5180_0981
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5180_0981
   00310 Lysine degradation
    CCDC5180_0981
   00360 Phenylalanine metabolism
    CCDC5180_0981
   00380 Tryptophan metabolism
    CCDC5180_0981
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5180_0981
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5180_0981
   00281 Geraniol degradation
    CCDC5180_0981
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5180_0981
   00627 Aminobenzoate degradation
    CCDC5180_0981
   00930 Caprolactam degradation
    CCDC5180_0981
Enzymes [BR:mtl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5180_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AEJ49818
Position
complement(1191434..1192471)
Genome map
AA seq 345 aa AA seqDB search
MTGESHEVLTNVEGGVGFVTLNRPKAINSLNQTMVDLLATVLMSWEHEDAVHAVVLSGAG
ERGLCAGGDVVAVYHSARKDGVEARRFWRHEYLLNALIGRFAKPYVALMDGIVMGGGVGV
SAHANTRVVTDTSKVAMPEVGIGFIPDVGGVYLLSRAPGALGLHAALTGAPFSGADAIAL
GFADHFVPHGDLDAFTQKIVTGGVESALAAHAVEPPPSTLAAQRDWIDECYAGDSVADIV
AALRKQGGEPAVNASDLIASRSPIALSVTLQAVRRAAKLDTLEDVLIQDYRVSSASLRSH
DLVEGIRAQLIDKDRNPNWSPATLDAITAADIEAYFEPVDDDLSF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcgaatcgcatgaggtcctgacaaacgtcgagggcggtgtcggattcgtgacg
ctcaaccgccccaaggcgatcaactcactgaaccaaaccatggtcgacctgctggccaca
gtgctcatgagctgggagcatgaggacgcggtgcacgcggtggtgctctccggagccggc
gaacgcggactttgcgccggcggggacgtggtggccgtctaccacagtgcccgcaaggac
ggggtcgaggcgcggcggttctggcgccacgagtatctgctcaacgccctgatcggccgg
ttcgccaagccctacgtggcgttgatggacggcatcgtaatgggcggcggcgtcggcgtc
agcgcacacgcgaacacccgggtggttaccgatacctccaaggtcgcgatgcccgaagtg
ggcatcgggttcatccccgacgtcggcggggtgtatttgctgtcgcgtgcacccggcgcg
ctgggtctgcacgccgccctgactggagcgccgttttccggcgccgacgccatcgcgctg
ggattcgccgaccacttcgtgccacacggcgacctcgatgcgttcacgcagaagatcgtc
accggcggcgtggagagcgcattggccgcccacgccgtcgaacctccaccgagcacgctt
gccgcccaacgtgattggatcgacgaatgctatgccggcgacagcgtcgccgacatcgtt
gcggcgctgcggaaacagggcggcgaaccagccgtaaatgcttccgacctgattgccagc
cgctcccccatcgcgctgtcggtgacgttgcaggcagtgcgtcgcgccgccaaactcgac
acgctagaagacgtgttgatccaggactatcgggtgtcatcggcgtcgctgcgctcgcat
gacctggtggagggcatccgcgcgcagttgatcgacaaggatcgcaacccgaactggtcg
ccggcaaccctggacgcgatcacggcggccgacatcgaagcctatttcgaaccggtcgac
gatgacttgagtttctag

DBGET integrated database retrieval system