KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_1464Help
Entry
CCDC5180_1464     CDS       T01992                                 

Definition
histidinol dehydrogenase hisD
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mtl00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1789433..1790767
Genome map
AA seq 444 aa AA seqDB search
MTAPPPVLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFG
ASFDGVRPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGA
TVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPHPTI
LAAARLLGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSR
VGIDAEAGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAG
QLQTTVHRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSA
GAIFVGPWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSG
HVITLATAEDLPAHGEAVRRRFER
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgccgccgcccgtgcttacccgtatcgacttgcggggagccgagttgacagct
gccgagctgcgggccgctctgccacgcggcggcgccgatgtggaagccgtgctgccgacg
gtacggcccattgtggcggccgtcgccgagcgcggggccgaggccgcgctggacttcggc
gcatcgttcgacggtgtgcggccccatgccatccgggtgccagacgcagcgctggacgcg
gcgctggccggactggactgcgacgtctgcgaagcgttgcaggtgatggtcgagcggacc
cgcgccgtgcactccgggcagcgtcgcaccgacgtcacaaccacactgggcccgggcgcg
acggtcaccgagcggtgggttccggtcgagcgggtaggcctgtacgtgccggggggcaat
gcggtgtacccatccagcgtggtgatgaacgtggtgcccgcccaagccgcgggcgtcgac
tcgttggtggtagccagcccgccgcaggcgcagtgggatggaatgccgcatccgaccatt
ctggccgcggcccggctgctgggcgtcgatgaggtctgggcggtcggcggcgctcaggcg
gtggcgttgctggcttacggcggcaccgacaccgacggcgcagcactgacaccggtcgac
atgatcaccgggcctggcaacatctatgtcacggccgccaagcgactgtgccgttcgcgg
gtgggcatcgacgccgaagcggggccaaccgagatcgctatcctcgccgatcacaccgcc
gacccggtgcatgtggccgccgacctgattagccaggccgaacacgacgagttggctgcc
agcgtgctggtcactccgagtgaggacctggccgatgccaccgacgccgaactggctggc
cagctgcagactacggtgcaccgcgaacgggtgacggccgcgctgaccggacgccaatcg
gcgatcgtcctggtcgacgacgtggacgccgccgtcttggtggtgaacgcttacgccgct
gagcatttggagattcagaccgccgatgccccgcaggttgccagccggatccgctcggcg
ggagccattttcgtcggcccgtggtccccggtgagcctcggcgactactgcgcgggatcc
aaccatgtactgccgaccgcgggctgcgcccggcattccagcggcctgtcggtgcagacg
ttcctgcgcggcatccacgtcgtggaatacacggaggcggccctcaaagacgtttccgga
cacgtgatcacgctcgccacggccgaggacttgccggcgcacggtgaggcggtacggcgg
aggttcgagcgatga

DBGET integrated database retrieval system