KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_1476Help
Entry
CCDC5180_1476     CDS       T01992                                 

Definition
indole-3-glycerol phosphate synthase trpC
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCDC5180_1476
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCDC5180_1476
Enzymes [BR:mtl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CCDC5180_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1800109..1800927
Genome map
AA seq 272 aa AA seqDB search
MSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREPGIGVIAEVKR
ASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRASVSIPVLRKD
FVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVHTEQEADRALK
AGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLAYAGAGADAVL
VGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggcaaccgtgctcgactccatcctcgagggagtccgggccgacgttgccgcg
cgtgaagcctcggtgagcctgtcggagatcaaggctgccgccgctgcggcgccgccgccg
ctcgacgtgatggccgccctacgcgagcccggcatcggcgtcatcgctgaggtcaagcgc
gctagtccttcggcaggcgcattggcgaccatcgccgacccggcaaagctggcccaggcc
taccaggatggcggtgcccggatcgtcagcgtggtgactgagcagcggcgttttcaggga
tcgctcgacgacctcgacgcggtgcgggcctcggtttcgattccggtgctgcgcaaggac
tttgtggtgcagccgtaccagattcatgaggcgcgtgcgcacggcgccgacatgttgttg
ctcatcgtcgccgcattggagcagtcggtgttggtgtcgatgttggaccgcaccgaatcg
ttgggtatgacagcactcgtcgaggtccataccgagcaggaagccgaccgagcgctgaag
gccggggccaaggtgattggcgttaacgcccgcgacctcatgacgctggacgtggaccgg
gattgcttcgcgcgaatagctcctggtttgccgagcagtgtgatcaggattgctgaatcc
ggcgtgcgtggcaccgctgacctgctggcgtacgccggcgcgggcgctgacgcggtgttg
gtaggcgaaggtctggtcaccagcggcgacccacgtgccgcggttgccgatctggttacc
gcgggcacccatccgtcctgtccgaaaccggctcgctag

DBGET integrated database retrieval system