KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_1476Help
Entry
CCDC5180_1476     CDS       T01992                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase trpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtl01100  Metabolic pathways
mtl01110  Biosynthesis of secondary metabolites
mtl01130  Biosynthesis of antibiotics
mtl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCDC5180_1476
Enzymes [BR:mtl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CCDC5180_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh
Motif
Other DBs
NCBI-ProteinID: AEJ50313
Structure
PDB: 

Jmol
Position
1800109..1800927
Genome map
AA seq 272 aa AA seqDB search
MSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREPGIGVIAEVKR
ASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRASVSIPVLRKD
FVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVHTEQEADRALK
AGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLAYAGAGADAVL
VGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggcaaccgtgctcgactccatcctcgagggagtccgggccgacgttgccgcg
cgtgaagcctcggtgagcctgtcggagatcaaggctgccgccgctgcggcgccgccgccg
ctcgacgtgatggccgccctacgcgagcccggcatcggcgtcatcgctgaggtcaagcgc
gctagtccttcggcaggcgcattggcgaccatcgccgacccggcaaagctggcccaggcc
taccaggatggcggtgcccggatcgtcagcgtggtgactgagcagcggcgttttcaggga
tcgctcgacgacctcgacgcggtgcgggcctcggtttcgattccggtgctgcgcaaggac
tttgtggtgcagccgtaccagattcatgaggcgcgtgcgcacggcgccgacatgttgttg
ctcatcgtcgccgcattggagcagtcggtgttggtgtcgatgttggaccgcaccgaatcg
ttgggtatgacagcactcgtcgaggtccataccgagcaggaagccgaccgagcgctgaag
gccggggccaaggtgattggcgttaacgcccgcgacctcatgacgctggacgtggaccgg
gattgcttcgcgcgaatagctcctggtttgccgagcagtgtgatcaggattgctgaatcc
ggcgtgcgtggcaccgctgacctgctggcgtacgccggcgcgggcgctgacgcggtgttg
gtaggcgaaggtctggtcaccagcggcgacccacgtgccgcggttgccgatctggttacc
gcgggcacccatccgtcctgtccgaaaccggctcgctag

DBGET integrated database retrieval system