KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_1478Help
Entry
CCDC5180_1478     CDS       T01992                                 

Definition
tryptophan synthase subunit alpha TrpA
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCDC5180_1478
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCDC5180_1478
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCDC5180_1478
Enzymes [BR:mtl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCDC5180_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1802231..1803040
Genome map
AA seq 269 aa AA seqDB search
MAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVP
YSDPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAFA
RDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFVY
AASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGSA
LVTALTEGLPRLRALTGELAAGVRLGMSA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtggaacagagcgaagcaagtaggctcgggccggttttcgattcctgccgtgca
aacaaccgcgcggcattgattggttacttgccgaccgggtacccggacgtgccagcgtcg
gtggccgcgatgacagcgctagttgaatccggttgcgacattatcgaagtcggggttccg
tattcggacccgggcatggacggccccaccatcgccagggcaaccgaggcggcgctccgt
ggcggggtgcgagtccgggatacgttagccgcggtcgaggccatcagtatcgccggcggg
cgtgcggtagtgatgacctactggaatccggtgctgcgctatggggttgatgcattcgcg
cgggatctggcggcggccggaggactcggcctgatcactcctgacctcattcccgacgag
gcgcaacagtggctggcggcatccgaagagcatcggttggatcgcattttcttggtcgcg
ccgtcctcgacaccggagcggttggcggccaccgtcgaggcttcacgcgggttcgtctac
gcggcgtcgacgatgggggtgaccggggcgcgggatgcggtgtcgcaggcggcacccgaa
ctggtgggccgggtgaaggcggtgtctgacataccggtgggcgtcggtctgggtgtgcgg
tcgcgcgctcaagccgcgcagatcgcccaatacgccgacggtgtcatcgttggttccgca
ttggtgacggcgctaaccgaggggttgcctagattgcgggcactgaccggagagctcgct
gccggggtacgactagggatgtccgcatga

DBGET integrated database retrieval system