KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_1478Help
Entry
CCDC5180_1478     CDS       T01992                                 

Definition
(RefSeq) tryptophan synthase subunit alpha TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCDC5180_1478
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCDC5180_1478
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCDC5180_1478
Enzymes [BR:mtl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCDC5180_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1802231..1803040
Genome map
AA seq 269 aa AA seqDB search
MAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGVP
YSDPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAFA
RDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFVY
AASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGSA
LVTALTEGLPRLRALTGELAAGVRLGMSA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtggaacagagcgaagcaagtaggctcgggccggttttcgattcctgccgtgca
aacaaccgcgcggcattgattggttacttgccgaccgggtacccggacgtgccagcgtcg
gtggccgcgatgacagcgctagttgaatccggttgcgacattatcgaagtcggggttccg
tattcggacccgggcatggacggccccaccatcgccagggcaaccgaggcggcgctccgt
ggcggggtgcgagtccgggatacgttagccgcggtcgaggccatcagtatcgccggcggg
cgtgcggtagtgatgacctactggaatccggtgctgcgctatggggttgatgcattcgcg
cgggatctggcggcggccggaggactcggcctgatcactcctgacctcattcccgacgag
gcgcaacagtggctggcggcatccgaagagcatcggttggatcgcattttcttggtcgcg
ccgtcctcgacaccggagcggttggcggccaccgtcgaggcttcacgcgggttcgtctac
gcggcgtcgacgatgggggtgaccggggcgcgggatgcggtgtcgcaggcggcacccgaa
ctggtgggccgggtgaaggcggtgtctgacataccggtgggcgtcggtctgggtgtgcgg
tcgcgcgctcaagccgcgcagatcgcccaatacgccgacggtgtcatcgttggttccgca
ttggtgacggcgctaaccgaggggttgcctagattgcgggcactgaccggagagctcgct
gccggggtacgactagggatgtccgcatga

DBGET integrated database retrieval system