KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_1624Help
Entry
CCDC5180_1624     CDS       T01992                                 

Definition
4-alpha-glucanotransferase malQ
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCDC5180_1624
Enzymes [BR:mtl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CCDC5180_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1994724..1996907)
Genome map
AA seq 727 aa AA seqDB search
MGDMTELAPSLVELARRFGIATEYTDWTGRQVLVSEATLVAALAALGVPAQTEQQRNDAL
AAQLRSYWARPLPATIVMRAGEQTQFRVHVTDGAPADVWLQLEDGTTRAEVVQVDNFTPP
FDLDGRWIGEASFVLPADLPLGYHRVNLRSGDSQASAAVVVTPDWLGLPDKLAGRRAWGL
AVQLYSVRSRQSWGIGDLTDLANLALWSASAHGAGYVLVNPLHAATLPGPAGRSKPIEPS
PYLPTSRRFVNPLYLRVEAIPELVDLPKRGRVQRLRTNVQQHADQLDTIDRDSAWAAKRA
ALKLVHRVPRSAGRELAYAAFRTREGRALDDFATWCALAETYGDDWHRWPKSLRHPDASG
VADFVDKHADAVDFHRWLQWQLDEQLASAQSQALRAGMSLGIMADLAVGVHPNGADAWAL
QDVLAQGVTAGAPPDEFNQLGQDWSQPPWRPDRLAEQEYRPFRALIQAALRHAGAVRIDH
IIGLFRLWWIPDGAPPTQGTYVRYDHDAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYL
LLRGLLGTSILWFEQDRDCGPAGTPLPAERWREYCLSSVTTHDLPPTAGYLAGDQVRLRE
SLGLLTNPVEAELESARADRAAWMAELRRVGLLADGAEPDSEEAVLALYRYLGRTPSRLL
AVALTDAVGDRRTQNQPGTTDEYPNWRVPLTGPDGQPMLLEDIFTDRRAATLAEAVRAAT
TSPMSCW
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacatgaccgagctcgcgccttcgctggtcgaacttgcccgacgattcggcatt
gccaccgagtacacggactggactggccggcaggtgctggtctccgaggctacattggtg
gctgctcttgccgccctcggcgttcccgcccagaccgaacagcaacgcaatgacgccctg
gccgcgcagctgcgatcctactgggcgcgtccattgccggcgaccatcgtcatgcgcgcc
ggagagcagacgcagttcagggtgcatgtgaccgatggcgctccggccgacgtgtggttg
cagctcgaggacggcacgacacgtgccgaggtggtgcaggtcgacaatttcaccccgcca
ttcgatcttgacggacgctggatcggcgaggccagcttcgtgttgcccgccgacctgccc
ctcggctaccaccgggtgaatctgcgttcgggcgactcgcaggccagcgccgctgttgtc
gtgacgccggattggttggggctgccggacaagctggcaggccgtcgtgcctggggcctg
gccgtccagctctacagcgtgcggtcccggcagtcatggggcatcggggatctcaccgat
ttggcgaatctcgcgctgtggtcggcgtctgcgcacggtgccggctatgtgctggtcaat
cccctgcatgcggctacgcttcccgggcccgctgggcgctcgaagccaatcgaaccatcg
ccctacctgccgacatcgcgacgcttcgtcaaccctctctaccttcgggtggaggccatt
ccggaactcgtcgatctgcccaagcgtggccgggtgcaacggttgcgcaccaacgtgcaa
cagcacgccgaccagctcgacaccattgaccgcgacagcgcctgggcggccaaacgcgca
gcactcaagctcgtgcaccgggtgccgcggtcggcgggtcgcgagctggcctacgccgcc
ttccgtacccgcgagggccgcgccctcgacgacttcgccacctggtgcgcgctggccgag
acgtacggcgatgattggcatcgatggccgaaatcgctgcggcatcccgatgcctcaggt
gtcgccgatttcgtcgacaaacacgccgatgccgtcgatttccaccgctggctgcagtgg
cagctggacgagcagctcgccagtgcgcagtcgcaggcgctccgggccggcatgtcgctg
ggcatcatggcagacctcgccgttggcgtgcaccccaacggggccgacgcctgggctctg
caggacgtgctggcccaaggtgtgaccgcaggtgcgccgccggatgagttcaaccaactc
ggccaggactggtcgcagccaccgtggcggccggaccggctcgctgagcaggagtaccga
ccgtttcgcgcgctgatccaggccgcgttgcggcacgccggtgcggtacgcatcgaccac
atcatcgggctgttccggttgtggtggatccccgacggcgcaccgcccacccaaggcacc
tatgtgcgctacgaccacgacgcgatgatcggcatcgtcgccctggaagcccaccgggcc
ggggcggttgtcgtcggtgaggatctcggcaccgtcgagccgtgggtacgcgactatcta
ctattgcggggcctgctgggcacctcaattctctggtttgagcaggatcgagattgcggg
ccggctggaacaccattgccggccgaacgctggcgggagtactgcttgtcgtcggtgacc
acccatgatctgccgccgaccgccggctacctggccggcgaccaggtacggctgcgcgag
tcccttgggttgttaaccaaccccgtggaggcggaactcgaatccgcccgggccgaccgg
gcagcctggatggccgagctgcgccgggtcggactgctggcggacggtgccgagcccgac
tcggaggaggccgtcctggctctctaccgctacctgggccgaacgccctcgcggctgttg
gcagtggcgttgaccgatgcggtcggcgaccgccggacgcaaaaccagcctggcaccacc
gacgagtacccgaactggcgggtgccgctcaccggccccgacggtcagccgatgctgctc
gaggacatcttcaccgatcgcagggcagccaccttggccgaggcggtgcgcgctgcgacg
acctcaccgatgagctgttggtga

DBGET integrated database retrieval system