KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_2221Help
Entry
CCDC5180_2221     CDS       T01992                                 

Definition
ribokinase rbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CCDC5180_2221
Enzymes [BR:mtl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CCDC5180_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2722864..2723709
Genome map
AA seq 281 aa AA seqDB search
MDLTFVVDALPRPGETVLAASLTRTPGGKGANQAVAAARAGAQVQFSGAFGDDPAAAQLR
AHLRANAVGLDRTVTVPGPSGTAIIVVDASAENTVLVAPGANAHLTPVPSAVANCDVLLT
QLEIPVATALAAARAAQSADAVVMVNASPAGQDRSSLQDLAAIADVVIANEHEANDWPSP
PTHFVITLGVRGARYVGADGVFEVPAPTVTPVDTAGAGDVFAGVLAANWPRNPGSPAERL
RALRRACAAGALATLVSGAGDCAPAAAAIDAALRANRHNGS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggacctgacgttcgtggtggacgcgcttccgcgccccggcgagacggtgcttgcggcg
tcgttgacccgaacgccaggcgggaagggcgccaaccaggcggtggccgcagcgcgcgca
ggcgcgcaggtacagttctccggtgcattcggcgacgatccagccgccgcccagctgcgg
gcccacctgcgcgccaacgccgttggactggacaggaccgtcacggtgcccggaccgagc
gggacggcgattatcgtggtcgatgccagcgccgagaacaccgtgctggtggcgccgggt
gccaatgcacatctgactccggtaccctcggccgtcgccaactgcgatgtactgttgacc
cagttggagattcctgttgcaaccgcgctggcagccgcgcgggcagcccagtcggccgat
gcggttgtcatggtcaacgcctccccagccggccaggatcgaagctccttgcaggacttg
gccgctatcgccgacgtggtgatcgccaacgagcatgaggcaaacgactggccgtcgcca
ccaacacatttcgtgatcaccctgggtgtgcgcggtgcccggtacgtcggcgcggacggg
gtgttcgaggtacccgccccaacggtaacgccagtggataccgccggcgccggcgacgta
tttgccggggtccttgctgcgaattggccgcgcaacccaggttcgccggccgagcgactg
cgcgcattgcggcgggcctgcgctgcgggtgcgctggcaactttggtgtccggtgccggc
gactgcgcaccggccgccgccgcgatcgatgcggccctgcgagccaaccgccacaacggt
tcatga

DBGET integrated database retrieval system