KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_2504Help
Entry
CCDC5180_2504     CDS       T01992                                 

Definition
dihydrofolate reductase dfrA (tetrahydrofolate dehydrogenase)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCDC5180_2504
   00670 One carbon pool by folate
    CCDC5180_2504
Enzymes [BR:mtl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CCDC5180_2504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3060228..3060713)
Genome map
AA seq 161 aa AA seqDB search
MTMVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLP
GRRNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIG
LPREAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatggtggggctgatctgggctcaagcgacatcgggtgtcatcggccgcggcggc
gacatcccctggcgcttgcccgaggaccaggcgcatttccgggagatcaccatggggcac
acgatcgtgatgggccggcgcacatgggattcgctgccggctaaagtccggccgctgccc
ggccggcgaaatgtcgtactgagccgccaagctgactttatggccagcggggctgaggtt
gtcggttcactcgaggaggcgctgaccagcccggagacgtgggtgatcggaggcggacaa
gtctatgcgctggcgctgccgtacgcgaccagatgtgaggttaccgaggtcgacatcggc
ctgccgcgcgaagccggtgacgcgctggcccccgtgctggacgagacatggcggggcgag
acgggggagtggcgcttcagccggtccgggttgcggtaccggttgtacagctaccaccgc
tcatga

DBGET integrated database retrieval system