KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_2599Help
Entry
CCDC5180_2599     CDS       T01992                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase dxr
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCDC5180_2599
Enzymes [BR:mtl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CCDC5180_2599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3162611..3163900)
Genome map
AA seq 429 aa AA seqDB search
MIRRRGDNEVVAHNDEVTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGL
AAGGAHLDTLLRQRAQTGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNAL
VGALGLRPTLAALKTGARLALANKESLVAGGSLVLRAARPGQIVPVDSEHSALAQCLRGG
TPDEVAKLVLTASGGPFRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVI
ETHLLFGIPYDRIDVVVHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLALGWPRRVSGA
AAACDFHTASSWEFEPLDTDVFPAVELARQAGVAGGCMTAVYNAANEEAAAAFLAGRIGF
PAIVGIIADVLHAADQWAVEPATVDDVLDAQRWARERAQRAVSGMASVAIASTAKPGAAG
RHASTLERS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgatccggcggcgcggtgacaacgaggtggtggcgcacaatgatgaggtgaccaactcg
accgacgggcgcgctgacggccggttgcgggtggtggtgctgggcagtaccggctcgatc
ggcacccaggcgcttcaggtcatcgccgacaatccggaccgtttcgaggtagtcgggctg
gccgctggcggcgcccatctggacacgttgctgcgacaacgtgcgcagaccggggtgacc
aatattgccgtcgctgacgagcacgcggcgcagcgggtcggcgacatcccctaccacgga
tccgacgccgccacccggctggtcgagcagaccgaggccgacgtcgtcctcaatgcgctg
gtcggcgcgttgggcctgcgaccgacgttggccgcgctcaagacgggtgcccggctggcg
ctggccaacaaggaatcgctggtcgccggtggttcgctggtgctgcgggcggcgcggccc
ggtcagatcgtgccggtcgactccgaacactccgcgctggcccagtgcctgcgcggcggc
actcccgacgaggtcgccaagctggtgctgacggcctcgggagggccgtttcggggctgg
tccgcggccgacctcgagcatgtcacccccgagcaggctggcgcgcatcctacgtggtcg
atgggcccgatgaacacgctgaattcggcgtcgctggtcaacaagggacttgaggtcatc
gaaacccacctgctgttcggcatcccctacgaccgcatcgatgtcgtggtgcacccccag
tcgatcatccattcgatggtcaccttcatcgacggttcgacgatcgcccaggccagtccc
ccggacatgaagctaccgatttcgttagcgctgggctggccgcgtcgggtcagcggcgcc
gctgctgcctgtgatttccataccgcgtcgagctgggagttcgagccgttggacaccgac
gtcttccccgcggtcgagttggcccggcaggccggcgtagccggtggctgcatgaccgcg
gtttacaatgcggcgaacgaagaagcagcagcggcgttccttgctggccggatcggcttc
ccggccatcgtcggcatcatcgccgacgtgttgcacgctgccgaccaatgggccgtcgaa
cccgctaccgtggatgacgtactcgacgcgcagcgctgggcccgcgagcgagcgcagcgc
gcggtatctggtatggcttcggtggcgatcgcaagcacggcgaagccgggcgcagcgggt
cgacacgcatcgacgttagaaaggtcctga

DBGET integrated database retrieval system