KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_2649Help
Entry
CCDC5180_2649     CDS       T01992                                 

Definition
formamidopyrimidine-DNA glycosylase fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3219544..3220464)
Genome map
AA seq 306 aa AA seqDB search
MVMTRCARLRRACDHHWMPELPEVEVVRRGLQAHVTGRTITEVRVHHPRAVRRHDAGPAD
LTARLRGARINGTDRRGKYLWLTLNTAGVHRPTDTALVVHLGMSGQMLLGAVPCAAHVRI
SALLDDGTVLSFADQRTFGGWLLADLVTVDGSVVPVPVAHLARDPLDPRFDCDAVVKVLR
RKHSELKRQLLDQRVVSGIGNIYADEALWRAKVNGAHVAATLRCRRLGAVLHAAADVMRE
ALAKGGTSFDSLYVNVNGESGYFERSLDAYGREGENCRRCGAVIRRERFMNRSSFYCPRC
QPRPRK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgacccgctgcgcccggcttcgccgcgcttgcgatcatcactggatgcccgag
ctgcccgaagtcgaggtggtgcggcgcggcttgcaggctcacgtgaccggccggaccatc
accgaggttcgggtgcaccacccccgcgctgtgcgccgccacgatgccgggcccgcggat
ctgacggcgcggctgcggggagcgcggatcaacggaaccgatcggcgcggcaagtacctg
tggttgacactcaatacggctggggtccataggccgacggacaccgcactcgtggtgcac
ctgggcatgagtgggcagatgctgctcggggcggtgccgtgtgccgctcacgtccggatt
tccgcgctgctcgacgacgggaccgtgctgagcttcgctgaccaacggaccttcggaggg
tggctgcttgccgacctggtgacggtggacggcagcgtggtaccggtgccggtcgcccac
ctggcgcgcgacccgcttgacccgcggttcgattgtgacgctgtagttaaagtgttgcgg
cgcaagcattccgaactcaagcgccagctgctggatcagcgggtggtgtcgggaatcggc
aacatctatgccgatgaggcgctgtggcgggccaaggtgaacggcgcccacgtcgccgcc
acactaaggtgccggcgtctgggagcggtcctgcatgccgccgccgacgtgatgcgcgaa
gcgctggcgaaaggtggcacctcgttcgactctttgtatgtcaacgtcaacggcgagtcg
ggctacttcgagcggtcgctggacgcttatggccgcgaaggcgaaaactgtcggcgctgc
ggcgcggtgatacgccgggagaggtttatgaaccgctcgtcgttctactgcccgcgatgc
cagccgcggccccgaaagtag

DBGET integrated database retrieval system