KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_2753Help
Entry
CCDC5180_2753     CDS       T01992                                 

Definition
transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CCDC5180_2753
Enzymes [BR:mtl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CCDC5180_2753
Glycosyltransferases [BR:mtl01003]
 Polysaccharide
  Storage polysaccharide
   CCDC5180_2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3375381..3376613
Genome map
AA seq 410 aa AA seqDB search
MVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEGVRVI
AAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKLGTDRSWRPDVVHAHDWLVAHPAIA
LAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMNDEITE
LFGPGLAEITVIRNGIDAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPRLRRT
HPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPSHYEP
FGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPAAAQR
RARAARQRLTSDFDWQTVATATAQVYLAAKRGERQPQPRLPIVEHALPDR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtgggagtacccgccggtggtgatcggcggactcggccgccacgtgcatcat
ctgtcgaccgcgctagccgcagccggtcacgatgtcgtcgtgttgtcccggtgtccgtcg
ggcaccgatcccagcacacacccatcctccgatgaggtgaccgaaggggtccgggtgatt
gcggccgcgcaggacccgcacgagttcacgtttggcaacgacatgatggcctggaccctg
gcgatgggccacgccatgatccgcgccgggctgcgcttgaagaaacttggcaccgaccgc
tcgtggcgtcctgacgtcgtgcacgcacacgactggctggtggcccatccggccatcgcc
cttgcccagttctatgacgtgccaatggtttccacgattcatgcaacggaggccggtcga
cattccggctgggtctccggagctctcagccgtcaggtgcacgcggtcgagtcgtggctg
gtgcgtgaatccgattcgctgatcacatgctcggcgtcgatgaacgacgagatcaccgag
ctgttcgggcccgggctggccgagatcaccgtgatccgtaacggcattgacgcggcgcgc
tggccgttcgcggcccgccgcccgcgcaccgggccagccgaattgctctatgtggggcgg
ctggagtacgagaagggcgtgcacgacgccatcgccgcgctgccgcggctcaggcgcact
cacccaggcaccacactgaccatcgccggcgaaggcacccagcaggattggttgatcgat
caggcccgcaaacaccgggtgctcagagcaaccaggttcgtcggacacctcgaccacacc
gagctgctggcgttgctgcaccgagccgacgccgcggtgctgcccagccactacgaaccg
tttgggctggtggcactggaggccgccgcggccggcaccccgctggtgacgtccaacatc
ggcggtctgggtgaagcggtcatcaatggacagaccggggtgtcgtgtgcaccccgcgac
gtagcggggctggccgccgcggtgcgtagcgtgctcgacgatccggccgccgcgcagcgg
cgcgcacgagccgcccggcaacggctcacctccgacttcgactggcagacggtggccacc
gcgaccgcgcaggtgtacctggcggcgaagcgcggtgaacggcagccgcagccccggttg
cccatcgtcgagcacgctcttcccgatcggtag

DBGET integrated database retrieval system