KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_3298Help
Entry
CCDC5180_3298     CDS       T01992                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCDC5180_3298
Enzymes [BR:mtl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CCDC5180_3298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4041984..4042550)
Genome map
AA seq 188 aa AA seqDB search
MTRVVLSVGSNLGDRLARLRSVADGLGDALIAASPIYEADPWGGVEQGQFLNAVLIADDP
TCEPREWLRRAQEFERAAGRVRGQRWGPRNLDVDLIACYQTSATEALVEVTARENHLTLP
HPLAHLRAFVLIPWIAVDPTAQLTVAGCPRPVTRLLAELEPADRDSVRLFRPSFDLNSRH
PVSRAPES
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggtagtgctctcggttggctccaacctgggtgaccgcctggcacgattgcgg
tcggtcgccgacggtctcggcgatgcgttgattgcggcttccccgatatatgaggccgac
ccctggggtggggtggagcaggggcagttcctcaatgcggtgctgatcgccgacgatcct
acctgcgaaccgcgggagtggctgcggcgggcgcaggagttcgagcgcgctgcgggcagg
gtgcgtggccagcgctggggtccacgaaatctcgacgtcgacctgatcgcctgctaccag
acctcggccaccgaggctctggtcgaagtgaccgcgcgggagaaccacctcacgctgccg
cacccactggcgcatctgcgggcctttgtgttgatcccgtggattgccgtcgacccaacg
gcgcagctgacggttgccgggtgcccgcggcccgtcacgcgactgctggccgagctggag
cccgccgaccgcgacagtgtgcggttgtttaggccgtcgttcgatctgaatagcagacac
cccgtcagtcgggcaccggaaagctga

DBGET integrated database retrieval system