KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_3300Help
Entry
CCDC5180_3300     CDS       T01992                                 

Definition
dihydropteroate synthase 1 folp
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mtl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4042941..4043768)
Genome map
AA seq 275 aa AA seqDB search
MQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGGESSRPGATRVDPAVE
TSRVIPVVKELAAQGITVSIDTMRADVARAALQNGAQMVNDVSGGRADPAMGPLLAEADV
PWVLMHWRAVSADTPHVPVRYGNVVAEVRADLLASVADAVAAGVDPARLVLDPGLGFAKT
AQHNWAILHALPELVATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVISALAA
LHGAWGVRVHDVRASVDAIKVVEAWMGAERIERDG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtgatgggggttctaaacgtcacggacgactctttctcggacggcgggtgttat
ctcgatctcgacgatgcggtgaagcacggtctggcgatggcagccgcaggtgcgggcatc
gtcgacgtcggtggtgagtcgagccggcccggtgccactcgggttgacccggcggtggag
acgtctcgtgtcatacccgtcgtcaaagagcttgcagcacaaggcatcaccgtcagcatc
gataccatgcgcgcggatgtcgctcgggcggcgttgcagaacggtgcccagatggtcaac
gacgtgtcgggtgggcgggccgatccggcgatggggccgctgttggccgaggccgatgtg
ccgtgggtgttgatgcactggcgggcggtatcggccgataccccgcatgtgcctgtgcgc
tacggcaacgtggtggccgaggtccgtgccgacctgctggccagcgtcgccgacgcggtg
gccgcaggcgtcgacccggcaaggctggtgctcgatcccgggcttggattcgccaagacg
gcgcaacataattgggcgatcttgcatgcccttccggaactggtcgcgaccggaatccca
gtgctggtgggtgcttcgcgcaagcgcttcctcggtgcgttgttggccgggcccgacggc
gtgatgcggccaaccgatgggcgtgacaccgcgacggcggtgatttccgcgctggccgca
ctgcacggggcctggggtgtgcgggtgcatgatgtgcgggcctcggtcgatgccatcaag
gtggtcgaagcgtggatgggagcggaaaggatagaacgcgatggctga

DBGET integrated database retrieval system