KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_3301Help
Entry
CCDC5180_3301     CDS       T01992                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCDC5180_3301
Enzymes [BR:mtl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CCDC5180_3301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4043780..4044388)
Genome map
AA seq 202 aa AA seqDB search
MSQLDSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLY
TDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGRVTGLSKIA
RLVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSA
VRGLFKTNAASRAEALDLILRK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagctggattcgcgcagcgcatctgctcgtatccgtgtgttcgaccagcaacgt
gccgaggccgcggtgcgcgaattgctgtacgcgatcggcgaggatccggatagggacggc
ttggtagccaccccgtcccgggttgcccggtcataccgcgaaatgttcgccgggctctac
accgaccccgactcggtgttgaacaccatgttcgacgaagaccacgacgagctggtgttg
gtcaaggaaatccctatgtactccacctgcgaacaccacctggtggcgttccacggtgtg
gcccacgtcggctacatcccgggcgacgacggcagggtgaccggcttgtcaaagatcgcg
cgactggtcgatctgtacgccaagcgacctcaggtccaggagcggctcaccagtcagatc
gccgatgccctgatgaaaaaactcgatccacgcggggtaatcgtggtgatcgaggctgag
catctgtgcatggcgatgcgcggggttcgcaagcccggctcggtcaccactacgtcggcg
gtgcgcggactgttcaaaaccaatgccgcttctcgagccgaagcgctcgacctcattttg
cggaagtga

DBGET integrated database retrieval system