KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_3378Help
Entry
CCDC5180_3378     CDS       T01992                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CCDC5180_3378
Enzymes [BR:mtl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CCDC5180_3378
Exosome [BR:mtl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCDC5180_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4132645..4134198)
Genome map
AA seq 517 aa AA seqDB search
MSDAILGEQLAESSDFIAAIDQGTTSTRCMIFDHHGAEVARHQLEHEQILPRAGWVEHNP
VEIWERTASVLISVLNATNLSPKDIAALGITNQRETTLVWNRHTGRPYYNAIVWQDTRTD
RIASALDRDGRGNLIRRKAGLPPATYFSGGKLQWILENVDGVRAAAENGDALFGTPDTWV
LWNLTGGPRGGVHVTDVTNASRTMLMDLETLDWDDELLSLFSIPRAMLPEIASSAPSEPY
GVTLATGPVGGEVPITGVLGDQHAAMVGQVCLAPGEAKNTYGTGNFLLLNTGETIVRSNN
GLLTTVCYQFGNAKPVYALEGSIAVTGSAVQWLRDQLGIISGAAQSEALARQVPDNGGMY
FVPAFSGLFAPYWRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMEADSGVRL
QVLKVDGGITGNDLCMQIQADVLGVDVVRPVVAETTALGVAYAAGLAVGFWAAPSDLRAN
WREDKRWTPTWDDDERAAGYAGWRKAVQRTLDWVDVS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacgccatcctaggagagcaattggccgagtcctcggatttcatagccgccatc
gaccagggcaccaccagcacccgctgcatgatcttcgatcaccacggtgccgaggtggcc
cgccaccagctcgagcacgagcagatcctgccccgggccggctgggtggagcacaacccg
gtcgagatctgggagcgcaccgcgtcggtgttgatctcggtgctcaacgccaccaaccta
tcgccgaaagatattgccgcgttggggattaccaaccaacgtgagacgacgctggtatgg
aatcggcacaccggacggccctactacaacgcgattgtatggcaggatacccgcaccgac
cgcatcgcgtcggcgctggatcgagacggtcgtggaaacctgatccgccgcaaggcgggc
ctgccgccggcaacttatttctctggcggcaagctgcagtggatcctggaaaatgtcgat
ggagtccgcgcggccgccgagaacggcgacgcattgttcggcacaccggacacctgggtg
ttgtggaatctgaccggcgggccgcgggggggtgtgcatgtcaccgatgtaaccaacgcc
agccggaccatgttgatggatctagagacgctggactgggacgacgagctgttgtcgttg
ttttcgatacctcgggccatgctgcccgagatcgcatcgtcggcgccgtcggagccttac
ggtgtcacgctggcgaccgggcctgtcggcggtgaggtgccgatcaccggagttctcggt
gatcagcatgcggccatggtcggtcaagtctgtctggccccaggggaggcgaaaaacacc
tatgggaccggcaattttctgctgctgaacaccggtgaaacgatcgtgcgatcgaataac
ggcctgctaaccacggtgtgctaccaattcgggaacgctaaacccgtgtacgcgcttgaa
ggttcgatcgcggtgaccggctcggcggtgcagtggctacgcgatcagctgggcatcatc
agcggcgccgcacagagtgaggcgctggcccgccaggtccccgacaacggcggcatgtat
ttcgtgccggcgttttccgggctgttcgcgccatactggcggtccgatgcgcgcggcgcg
atcgtcgggttgtcgcggttcaacaccaacgcgcacctggcgcgcgcaacgctggaggcg
atctgctaccagagccgcgatgtggtggacgccatggaagcagactccggtgttcgcctg
caggtgttgaaggtggatggcgggatcaccggcaacgacctgtgtatgcagatccaggcc
gacgtgttgggtgtggatgtggtgcggccggtggtcgccgagaccaccgcactaggtgtg
gcctacgcggcgggcttggcggtcgggttctgggcggctccgtccgatctgcgggccaac
tggcgagaggacaagcggtggacaccgacgtgggacgacgacgagcgtgccgcgggttat
gccggctggcgcaaggcggtgcagcggaccctggattgggttgacgtgtcctag

DBGET integrated database retrieval system