KEGG   Thermothelomyces thermophila: MYCTH_100068Help
Entry
MYCTH_100068      CDS       T02231                                 

Definition
(RefSeq) glycoside hydrolase family 11 protein
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mtm  Thermothelomyces thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     MYCTH_100068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_11 CBM_1 Toxin_7
Motif
Other DBs
NCBI-GeneID: 11512455
NCBI-ProteinID: XP_003662402
JGI: 100068
UniProt: G2Q913
Position
2:complement(join(5265193..5265769,5265898..5266157))
Genome map
AA seq 278 aa AA seqDB search
MVALSSLLVAASAAAVAVAAPSEALQKRQTLTSSQTGFHDGFYYSFWTDGAGNVRYTNEA
GGRYSVTWSGNNGNWVGGKGWNPGAARNISFTGQYNPNGNSYLAVYGWTRNPLIEYYIVE
NFGTYDPSTGAQRLGSITVDGSTYNILKTTRVNQPSIEGTSTFDQFWSVRTNKRSSGSVN
VKAHFDAWAQAGLRLGTHDYQIMATEGYFSSGSATITVGEGTSSGGGGDNGGGNNGGGGN
TGTCSALYGQCGGQGWTGPTCCSQGTCRVSNQWYSQCL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggttgctctctcttctctcctcgtcgctgcctctgcggcggccgtggccgtggctgcg
ccgagcgaggccctccagaagcgccagacgctcacgagcagccagacgggcttccacgac
ggcttttactactccttctggaccgacggtgccggcaacgtccggtacacgaacgaggcc
ggcggccggtacagtgtcacctggtccggcaacaacggcaactgggttggcggcaagggc
tggaacccgggggctgctcgcaacatcagcttcacggggcagtataaccccaacggcaac
tcgtacctggccgtgtacgggtggacgcgcaacccgctgatcgagtactacatcgtcgag
aacttcggcacgtacgacccgtcgacgggggcgcagcggctcggcagcatcacggtggac
gggtcgacgtacaacatcctcaagacgacgcgggtcaaccagccgtccatcgagggcacc
agcacctttgaccagttctggtccgtccggaccaacaagcgcagcagcggctccgtcaac
gtcaaggctcacttcgacgcttgggcccaggccggcctccgcctgggcacccacgactac
cagatcatggccaccgagggctacttctcgagcggctccgccaccatcaccgtcggcgag
ggcaccagcagcggcggcggcggcgacaatggcggcggcaacaacggcggcggcggcaac
accggcacctgcagcgccctgtacggccagtgcggtggccaggggtggacgggcccgact
tgctgctcccagggaacctgccgcgtctccaaccagtggtactcgcagtgcttgtaa

DBGET integrated database retrieval system