KEGG   Myceliophthora thermophila: MYCTH_101224Help
Entry
MYCTH_101224      CDS       T02231                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
mtm  Myceliophthora thermophila
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MYCTH_101224
  Amino acid metabolism
   00380 Tryptophan metabolism
    MYCTH_101224
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MYCTH_101224
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     MYCTH_101224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(5032687..5033559,5033673..5035094,5035228..5036001,5036073..5036119,5036180..5036306))
Genome map
AA seq 1080 aa AA seqDB search
MADKTTETVPIPGPPGLPLVGNALAFDSELPLRTFQEFAEEYGEIYRLTLPTGTTLVVSS
QALVHELCDDKRFKKPVAAALAEVRNGVNDGLFTAREEEPNWGIAHRILMPAFGPASIQG
MFTEMHEIASQLALKWARHGPDTPIFVTDDFTRLTLDTLALCTMNFRFNSYYHDELHPFI
NAMGNFLTESGARAMRPAITSIFHQAANRKYWEDIEVLRKTAQGVLDTRRKHPTNRKDLL
SAMLDGVDAKTGQKLSDSSIIDNLITFLIAGHETTSGLLSFAFYLLIKHQDAYRKAQEEV
DRVIGKGPIKVEHIKKLPYIAAVLRETLRLCPTIPIINRAAKQDEVIGGKYAVAKDQRLA
LLLAQSHLDPAVYGETAKQFIPERMLDENFERLNREYPDCWKPFGTGMRACIGRPFAWQE
AVLVMAMLLQNFDFVLHDPYYELHYKQTLTTKPKDFYMRAILRDGLTATELEHRLAGNAA
SVARSGGGGGGPSKPTAQKTSPAEAKPMSIFYGSNTGTCESLAQRLATDAASHGYAAAAV
EPLDTATEKLPTDRPVVIITASFEGQPPDNAAKFCGWLKNLEGDELKNVSYAVFGCGHHD
WSQTFHRIPKLVHQTMKAHGASPICDEGLTDVAEGNMFTDFEQWEDDVFWPAVRARYGAA
GAVAETEDAPGSDGLNIHFSSPRSSTLRQDVREATVVGEALLTAPDAPPKKHIEVQLPDG
ATYKVGDYLAVLPVNSKESIGRVMRKFQLSWDSHVTIASDRWTALPTGTPVPAYDVLGSY
VELSQPATKRGILRLADAAEDEATKAELQKLAGDLYTSEISLKRASVLDLLDRFPSISLP
FGTFLSLLPPIRPRQYSISSSPLNDPSRATLTYSLLDSPSLANPSRRFVGVATSYLSSLV
RGDKLLVSVRPTHTAFRLPDEDKMGETAIICVGAGSGLAPFRGFIQERAALLAKGTQLAA
ALLFYGCRSPEKDDLYRDEFDKWQESGAVDVRRAFSRVDSDDTEARGCRHVQDRLWHDRE
EVKALWDRGARVYVCGSRQVGEGVKTAMGRIVLGEEDAEDAISKWYETVRNDRYATDVFD
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaagacaacggagacggtaccgataccggggcccccgggactgcccctcgta
ggcaatgctcttgcgttcgactcggagctgcctcttcgaacgttccaagagttcgctgaa
gaatacggagagatataccgcctgacccttcccaccgggaccactctggttgtgagctcc
caggcgctcgtccatgagctatgtgatgacaagagattcaaaaagcccgtcgcggctgcc
ctcgccgaggttcgaaacggcgtcaacgatggcctcttcaccgctcgggaagaagagccc
aactggggcatcgctcaccggatcctgatgcctgcgtttggaccggcctcgatccagggc
atgttcaccgagatgcacgagattgcgtcgcagctggcgctcaagtgggcgcgccacggt
ccggacacgcccatctttgtaacagatgacttcacacgcctgacgctcgacactctcgcc
ctctgcaccatgaatttccgcttcaactcgtactaccacgacgagctgcatccgttcatc
aacgctatgggcaacttcctcacagagtcgggtgcaagggccatgcggccggccatcacc
tccatcttccaccaggcggcgaaccgaaagtactgggaggatatcgaggttctgcggaag
acggcccagggagtcctggatacgcgaaggaagcaccccaccaaccggaaggacctccta
tccgccatgttggacggcgtagacgcaaaaaccggccagaaactgagcgactcgtccatc
atcgacaacctcatcaccttcctcattgccggtcacgagacgacctcgggcttgctgagc
ttcgccttctacctcctgatcaagcaccaggatgcgtaccgcaaggcgcaagaagaggtg
gacagggtcataggcaagggaccgatcaaggtcgagcacatcaagaagcttccttacatt
gccgccgtcctccgcgagacgctgcgcctctgtcccacgatcccaataatcaatcgagcg
gccaagcaggacgaggtgattgggggcaagtatgccgtcgcaaaggatcagaggctcgct
cttctcctggctcagtctcacctggaccccgctgtctatggagagactgcgaaacagttc
atcccggagcggatgctggacgagaactttgagcgcctgaacagggagtatccagactgt
tggaagccgttcggaaccggcatgcgggcatgcatcggccgcccgtttgcctggcaggag
gcggtcctcgtcatggccatgctgttgcagaattttgattttgtcctccacgacccctac
tacgagctgcattacaagcagaccctcacaaccaagcccaaggacttctacatgcgggcc
attcttcgagacggcctgacggcaaccgagctggagcaccggctcgccgggaacgcggcc
tcggtcgcgcggtcgggcggcggcggcggcggcccctccaagccgaccgcacagaagacc
tctcccgccgaggccaagccgatgagcatcttttacggctccaacacgggcacgtgcgag
agcctggcccagcgcctcgcgaccgacgcggcgtcccacgggtacgcagccgccgccgtc
gagcccctggacacggcaacggagaagctgccgaccgaccggcccgtggtgatcatcacg
gcctcctttgaaggtcagccgccggacaacgcggccaagttctgtggctggctcaagaac
ctcgagggcgacgagctgaagaacgtctcttacgccgtcttcggctgcgggcaccatgac
tggtcccagaccttccaccgcattcccaagctcgttcaccagacgatgaaggctcacggc
gcctcgcccatctgtgacgaggggttgacggacgtggccgaggggaacatgtttaccgac
tttgagcagtgggaagacgacgtgttctggccggccgtcagggcgcggtacggagccgcc
ggggctgtggccgagaccgaggatgcgccgggctccgacggcctcaacatccacttctcc
agcccccggtcgtccaccctccgccaggacgtcagggaggcgacggtcgtcggggaggcg
ctactcaccgctcccgacgccccgccaaagaagcatatcgaggtccagcttcccgacggc
gcgacgtacaaggtcggggactatctcgccgtgctccccgtcaactccaaggagagcatc
ggccgcgtcatgcggaaattccagctttcctgggactcgcacgtcaccattgcctccgac
cgctggaccgccctgccgacgggcacgccggttccggcgtacgatgtgctcgggtcctat
gtcgagctgtcacagccggcgacgaagagggggatcttgcggctcgccgatgccgctgaa
gacgaagccactaaggcggagctccagaagcttgcgggtgacttgtacaccagcgagatc
agcctcaagcgcgcctccgtcctcgacctcctggaccgctttccttccatctcgcttccg
ttcggcactttcctctccttgctcccgcccatccgcccgaggcagtactcgatatcctcc
tcgccgctcaacgacccctcgcgggcaacgctcacgtactcgctgctcgactcgccgtcg
ctggccaacccgtcccgacggttcgtgggcgttgcgacctcgtatctctcctccctcgtc
aggggcgacaagctcctggtctcggtacggcccacccacacggcgttccggctgccggac
gaagacaagatgggcgagacggccatcatctgcgtcggtgccgggtccgggctcgcgccg
ttccggggcttcatccaagagcgcgccgcgctcctcgccaaggggacgcagctcgccgcc
gcgctgctcttctacggctgccgcagcccggagaaggacgatctctaccgcgacgagttc
gacaagtggcaggagtcgggcgcggtcgacgtccggcgggcgttcagccgcgtcgactcg
gacgacacggaggcgcgcgggtgcaggcacgtgcaggacaggctgtggcacgaccgggag
gaggtgaaggcgttgtgggaccgcggcgccagggtgtacgtctgcggctcgcggcaggtc
ggagaaggggtcaagacggccatgggcagaatcgtgcttggtgaggaggacgccgaggac
gcgatctcaaagtggtatgagaccgttcggaacgaccggtatgccacagatgtctttgac
taa

DBGET integrated database retrieval system