KEGG   Myceliophthora thermophila: MYCTH_103702Help
Entry
MYCTH_103702      CDS       T02231                                 

Definition
(RefSeq) aldose epimerase-like protein
Organism
mtm  Myceliophthora thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(753434..753532,753662..753761,753836..754162,754329..754845,754950..755043)
Genome map
AA seq 378 aa AA seqDB search
MAAEASVIGRERHVPPPGEDGRYTISAEGIKAQFIPYGATLTNLFVKDKNGEDIDVVLGY
DDVNYYPEDPGHPVYNAIPGRYANRIGNGKYTLDGKTYFTEKNDGNNTLHSGTNNWSYRV
WDVTDLKEDSITFSILDKANSSQGFPGDVKASVTYSVKGSTWNIKMKAEALNHKTPLLLT
QHTYFNLDAYHNPDTAKIWDHGLYLPYSKRYLEGDQGALPTGKILTAEPGSINDFASSAD
LTVGHARDQPGFEGNCGADGACEGYNGYFLIEDKPSADAVVLRLSSAFSGVTADLRTDQP
GVVLYSCNWMDGSADLKSTQGIKGVNEKVIRSSCIAIEAQDYPDGINHPEWGRTEAQIWG
PGETYTWESSWTFGLLEA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaagcgtccgtgatcggcagagaacgtcacgtcccgccgcctggcgaggat
gggcgctacaccatatctgcggagggtatcaaggcgcagttcatcccgtacggcgccacc
ctgaccaacttgttcgtcaaggacaagaacggcgaggacattgacgtggtgctcggctac
gacgatgtcaactattaccccgaggaccccggccatccggtgtacaacgccattcccggc
cggtacgccaaccggatcggcaacgggaagtacactctcgacgggaagacgtacttcacc
gagaagaacgacggcaacaacacgctgcacagcggcaccaacaactggtcgtaccgcgtg
tgggacgtgaccgatctcaaggaggactccatcaccttctcgatcctggacaaggccaat
tcgtcccagggcttcccgggcgacgttaaagcgtccgtcacgtactcggtcaagggttcg
acctggaacatcaagatgaaggccgaggctctgaaccacaagacccccctcctgctcact
cagcacacctacttcaacctggacgcctaccacaacccagacacggccaagatctgggac
cacgggctgtacctgccgtactcgaagcggtacctcgagggcgaccagggggcgctgccg
acgggcaagatcctgactgcggagcccgggtcgatcaacgacttcgcgtcgtcggcggac
ctgacggtcgggcacgcgcgggaccagcccgggttcgagggcaactgcggggccgacggc
gcctgcgagggctacaacggctacttcctgatcgaggacaagccgtccgccgacgccgtc
gtcctccgcctgtcgagcgccttctcgggcgtcaccgccgacctgcgcaccgaccagccc
ggcgtcgtcctctactcgtgcaactggatggacggctccgccgacctcaagagcacccag
ggcatcaagggcgtcaacgagaaggtcatcaggagcagctgcatcgccatcgaagcccag
gactacccggatggcatcaaccatcctgaatggggacgtaccgaagcgcagatctggggc
ccgggtgagacgtacacgtgggagagctcgtggacctttgggttgctcgaagcctga

DBGET integrated database retrieval system