KEGG   Myceliophthora thermophila: MYCTH_107723Help
Entry
MYCTH_107723      CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCTH_107723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(1429720..1429738,1429794..1431256)
Genome map
AA seq 493 aa AA seqDB search
MSSDEAWSTSSNDALLLSLVTPSATGVKTIGHSFHPKFTYSLFGDNEEIFGYKDLEINLR
YNASDMRPNLSVTYSKKFPGVGDTEATDINGVLREILPDVAFQSKKDFETAVNGLRKDWT
PPGKLITTFRSHGNTFEVWKGTLADPAVKQVARRIQILAPLFIEGGTAINVDDSDADRWT
VFFLYQKKATPSDASGNPYVFAGYSTVYRFFHFRPLTPPVTPSESEVEKAMLAQDFDLSQ
LPCRSRISQFIILPPFQGKGLGSRLYSCVFKEYIQHPQTVEITVEDPNEAFDDLRDIANL
HYLRQLPEFQALRINTDVAIPKVGAAPNNIVDQAAYDAVRAKAKMAPRQFARVLEMHLMS
QLPEPVRPGISPEKQAAKATKEQEHEYRLWRLILKKRIYKHNKDALGELEIPERIAKLEE
TVSSVEFDYARLLIKAEEQLKNMAEDERKDEAAAAAAAAAAAAGPNGSPANGKRKAADDT
QEQASKKARVEDE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgacgaggcttggtcaacgtcgtccaacgacgcgctcctcctgtccctcgtg
acgccttctgcgacaggcgtcaaaaccatcggccacagctttcacccgaaattcacatat
tcgctctttggcgacaacgaggagattttcggctataaagatctcgaaatcaatctccgg
tacaatgcgagtgatatgcgacctaacctgtccgtcacatacagcaagaaattccccggc
gtgggggatacggaggcgaccgacatcaatggtgtcttgcgcgagatccttcccgacgtc
gcctttcagagtaaaaaggatttcgaaactgcggtcaacggcctccggaaagactggact
cctcccggcaagcttattaccacgttccgctcccatggcaacacgttcgaggtttggaag
gggactctggccgaccccgccgtgaaacaggttgctaggcgcatccagatactcgcacct
ctcttcattgaaggcggtactgccatcaacgtggacgattccgatgccgaccggtggacg
gttttcttcctgtaccagaaaaaggctacccccagcgatgccagcggaaacccttatgtt
ttcgccggctactccacggtctaccgcttcttccactttcggccacttacacccccggtc
actccgtcagagagcgaggtggaaaaggcaatgctcgcccaggactttgacctgtctcaa
cttccctgccgtagcaggatctcccagttcatcattctcccgcccttccaaggcaagggg
ctaggttccaggctatacagctgtgtcttcaaggaatacatccagcacccgcagacagtt
gagatcacggtcgaggaccccaacgaggcgttcgacgacctgcgcgacatcgcgaacctg
cactacctgcgccagctgcccgagttccaggcgctgcgcatcaacacggacgtcgccatc
cccaaagtgggtgccgcgccaaacaacattgtcgaccaggccgcgtacgacgcggtgcgc
gccaaggccaagatggcgccccgccagttcgcgcgcgtcctggagatgcacctcatgtcg
cagctgcccgagcccgttcggcccggcatctccccggagaagcaggcggccaaggcgaca
aaggagcaggagcatgaataccgcctctggaggctgattctcaagaagaggatatacaag
cacaacaaggacgccctgggcgagctggagatccccgagcgcatcgccaagcttgaggag
acggtgtcgagcgttgagttcgactatgcgcggctcctgatcaaggccgaggagcagctg
aagaacatggccgaggacgagcggaaggatgaggctgctgctgctgctgctgctgctgct
gctgctgctgggcctaatgggtcaccagcgaatggaaagcgcaaggcggctgacgacacg
caggagcaggctagcaagaaggcaagggtcgaggatgaatga

DBGET integrated database retrieval system