KEGG   Myceliophthora thermophila: MYCTH_109620Help
Entry
MYCTH_109620      CDS       T02231                                 

Definition
delta-9 acyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mtm01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mtm01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(9223035..9223638,9223705..9223839,9223907..9224309,9224373..9224549,9224610..9224718))
Genome map
AA seq 475 aa AA seqDB search
MASSSSEVPVPQAESFPDGRTDYIPLRKKNYDARKPHITEQPITWSNWYKHVNWLNTYFI
IIVPLIGLISAYWIELQFKTAVFAVAYYFFAGLGITAGYHRLWAHSSYKATLPLKIFLAA
GGAAAVEGSARWWSSLHRSHHRYTDTDKDPYSVRKGLLYSHIGWMVMKQNPRRIGRTDIT
DLNEDPVVVWQHRNYLKCVVTMALIVPTLVCGLGWGDYLGGFVYGGILRIFFIQQATFCV
NSLAHWLGEQPFDDRNSPRDHVITALVTLGEGYHNFHHEFPSDFRNAIEWWQYDPTKWFI
WTMKLLGLAYNLKTFPQNEIEKGRVQQLQKKLDQKRATLDWGKPLESLPVISWDEFVEQS
KNGKAWIAVAGVIHDVGKFIADHPGGKALISSAIGKDATAVFNGGVYNHSNAAHNLLSTM
RVGVLRGGCEVEIWKRAQSENKDVNPVTDSSGQRIVRAGDQVTRVNRPIPTADTA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcctcgtctgaggtgccggtgccccaggccgagagctttccggacggcagg
accgactacattcccctgcggaagaagaactacgatgcccgcaaacctcacatcaccgag
cagccgataacgtggtccaactggtacaaacacgtcaactggttgaacacttatttcatc
atcatcgtccccttgatcggtctgatttccgcgtactggatcgagctgcaattcaagacg
gcggtgttcgctgtggcctattacttcttcgccggtctgggaatcaccgccggttaccat
cgtctgtgggctcactcgagctacaaggcgacccttcctctcaagattttcctcgcggct
ggtggtgccgcagcggtcgagggcagcgctcgctggtggtctagcctccaccgctcgcat
caccgctacaccgacacggacaaggatccctactcggtccgcaagggcctgctctacagc
catattggatggatggttatgaagcagaaccctcgccgtatcggccgcaccgatatcacc
gacctgaacgaggacccggttgtcgtgtggcagcatcgcaactacctcaagtgcgtcgtg
actatggccctgatcgtgcctacgcttgtctgcggccttggctggggtgattacttgggt
ggcttcgtctatggcggtatcctgcgaatcttcttcattcagcaggccaccttctgcgtc
aatagcttggcccactggctcggcgagcagccttttgacgaccgcaactcaccgagagac
catgtgatcacggctctcgttacccttggcgagggctaccacaacttccaccacgagttc
cccagcgatttccgtaacgctattgagtggtggcagtacgaccccaccaagtggtttatc
tggaccatgaagcttctcggcctcgcctacaacctcaagaccttcccccagaacgagatt
gagaagggccgtgtgcagcagctgcagaagaagctcgatcagaagcgcgccaccctcgac
tggggtaaaccccttgagagtctccccgtcatcagctgggacgagttcgtggagcagtcg
aagaacggcaaggcgtggatcgctgtcgctggtgtcattcacgacgtcgggaagttcatt
gctgatcaccccggtggcaaggctttgatctcgtcagccatcggcaaggatgccaccgcc
gtcttcaacggcggtgtctacaaccactccaacgccgcccacaacttgctgtccaccatg
agagtcggtgtattgaggggcggctgcgaggtcgagatttggaagcgcgctcagtcggag
aacaaggatgtgaacccggttaccgattcctccggtcagcgcattgttcgcgccggcgac
caggtcacccgcgtcaatcgccctattcccacggcagacactgcttaa

DBGET integrated database retrieval system