KEGG   Myceliophthora thermophila: MYCTH_110871Help
Entry
MYCTH_110871      CDS       T02231                                 

Definition
isocitrate lyase-like protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mtm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mtm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(4664541..4664771,4664897..4665052,4665150..4665492,4665643..4666195,4666315..4666672)
Genome map
AA seq 546 aa AA seqDB search
MAANNMINPAVDPNLEDELFAKEVEEVKRWWSEPRWRYTKRPFTAEQIVNKRGNLKIEYA
SNTQSKKLWNILEKRFKERDASYTYGCLEPTAVTQMAKYLDTVYVSGWQSSSTASSSDEP
GPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERMSVPKAQRAKLPNIDYLRPIIADADT
GHGGLTAVMKLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQA
DIMGSDLIAIARTDAEAATLITSTIDPRDHAFILGSTNPNLQPLNDLMLAAERAGKAGAE
LQAIEDKWLEQANLKRFDDAVLDAIAGMPNAQSLADQYRSAIKGKQLSNAEARAIARRIL
GRDIYFDWDAPRTREGYYRLKGGCDCSINRAIAYAPYCDAIWMESKLPDYKQAEEFARGV
HAVWPEQKLAYNLSPSFNWKAAMPREEQETYIRRLAKLGYCWQFITLAGLHTTALISDRF
AQAYARQGMRAYGELVQEPEMELGVDVVKHQKWSGAAYVDELQKMVTGGVSSTAAMGKGV
TEEQFH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaataacatgatcaatcccgccgtggatcccaacctggaggacgaactcttc
gccaaggaggtcgaggaggtcaagaggtggtggagcgagccacgatggcggtacacgaag
cggccctttaccgcggagcagattgtcaacaagcgcggcaatctcaagattgagtacgcc
agcaacacacagagcaagaagttgtggaacatcctcgagaagcgtttcaaggaaagggac
gccagctacacgtacggctgcctggagcccactgccgtcacccagatggccaagtacctc
gacaccgtctacgtctcgggctggcagtcgtcatcgaccgcctcctcctcggacgagccc
ggtccggacctggctgactacccctacacgacggtgcccaacaaggtcggccatctcttc
atggcgcagctcttccacgaccgcaagcagcgccaggagcgcatgtcggtgcccaaggcc
cagcgcgccaagcttcccaacatcgactacctgcgccccatcatcgccgacgctgacacg
ggccatggcggtctgaccgccgtcatgaagctgaccaagctcttcattgagaagggcgcc
gccggcatccacatcgaggaccaggcgccgggcaccaagaagtgcggccacatggccggc
aaggtcctggtgcccattagcgagcacatcaaccgcctggtggccatccgcgcccaggcc
gacattatgggctccgacctcattgccatcgcgcggaccgacgccgaggcggccacgctc
atcacgtccaccatcgacccgcgcgaccacgccttcatcctgggcagcaccaaccccaac
ctgcagccgctcaacgacctgatgctggcggccgagagggccggcaaggcgggcgctgag
ctgcaggccatcgaggacaagtggctggagcaggccaacctcaagcgcttcgacgacgcc
gtgctggacgccatcgccggcatgcccaacgcgcagtcgctggccgaccagtaccgcagc
gccatcaagggcaagcagctgtccaacgccgaggcccgcgccatcgcccgccgcatcctc
ggccgcgacatttactttgactgggacgccccgcgcacccgcgagggctactaccgcctc
aagggcggctgcgactgctccatcaaccgcgccatcgcctatgccccttactgcgacgcc
atctggatggagagcaagctgcccgactacaagcaggcagaggaatttgcccgcggcgtg
cacgccgtctggcccgagcaaaaactcgcgtacaacctgtcgccctcgttcaactggaag
gcggcgatgccgcgggaggagcaggagacgtacatccggcggctggccaagctgggctac
tgctggcagttcatcacgctggcgggcctgcacacgacggcgctgatcagcgaccggttc
gcgcaggcctacgcgcgccagggcatgcgcgcctacggcgagctcgtccaggagcccgag
atggagctcggcgtcgacgtggtcaagcaccagaagtggagcggcgccgcctacgtcgac
gagctgcagaagatggtcaccggcggcgtcagctccaccgccgccatgggcaagggcgtc
accgaggagcagttccattaa

DBGET integrated database retrieval system