KEGG   Myceliophthora thermophila: MYCTH_112136Help
Entry
MYCTH_112136      CDS       T02231                                 

Definition
histone H2B-like protein
Orthology
K11252  
histone H2B
Organism
mtm  Myceliophthora thermophila
Brite
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MYCTH_112136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(3257906..3258068,3258158..3258229,3258284..3258462)
Genome map
AA seq 137 aa AA seqDB search
MAPKADKKPASKAPANVASKAPEKKDAGKKTAPSGDKKKRSKARKETYSSYIYKVLKQVH
PDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKH
AVSEGTKAVTKYSSSTK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggcccctaaggctgacaaaaagcccgcctcgaaggcccccgccaatgtggcctccaag
gctccggagaagaaggatgccggcaagaagaccgcgccctcgggcgacaagaagaagcgg
agcaaggctcgcaaggagacctactcctcctatatctacaaggtcctcaagcaggtccac
cccgacactggcatctccaaccgcgccatgtctattctgaactctttcgtgaacgatatc
ttcgagcgcgtcgccaccgaggcctctaagctcgctgcctacaacaagaagtcgaccatc
tcgtcgcgcgaaattcagacatcggtccgcctcatcctccccggcgagctggccaagcac
gccgtgtccgaaggcactaaggccgtcaccaagtactcgtccagcacgaaataa

DBGET integrated database retrieval system