KEGG   Myceliophthora thermophila: MYCTH_116363Help
Entry
MYCTH_116363      CDS       T02231                                 

Definition
alkaline phosphatase-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCTH_116363
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MYCTH_116363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(2419364..2419578,2419738..2420372,2420453..2420594,2420654..2420723,2420788..2420954,2421008..2421167,2421257..2421739))
Genome map
AA seq 623 aa AA seqDB search
MHILSTLSLAALSAPLASASFDGNINYLSPSRRHVNLGIDVPAVARRSMKRGAVPYKPSE
LNFTHGIASGDPYPDSVILWTRVAPSLASDNSNVTVEGTVDLYNHETEKYVKADPNPICV
EWKVWEAQEKGSKRPGHGGSGKHIVSQGTAYTTSDIDYTVKVEAKGLKPFTTYNYQFNVC
KSDNASPVGRTKTAPRENAKLDEINLAVFSCSNFPNGYFNAYGNAARKDKHDYVVHLGDY
IYEGAQGGERAHNPPRIIFSLWDYRTRHGQYRTDPDLQLLSQNYAWMPTWDDHEIANNGY
RDGFSALNNTEDSFRKDGPSISVDQRKMNAVRAYFEWMPIRQVDLDDNLRIWRSFKLGRL
LDLIILDTRNYDRSITSLGWNDHYIDLIRDDASRSLMGSRQEHWFYNQLAESSRRGAAWR
VVGSQVIFSDINNSGDTWSGYTANRNRTLKHLYDNKIGNNVFLAGDSHQNWVSDLAWLGE
KPYDSQTGEGAVGVEFAGTAVSSSGQSGPILAAREKARQQVEANELMQWQEGYYRGYFIL
RIREEAVTAQYFGSPSVATPNAWDLPLANFTIASGKNHLTRPVAGGNVEAGFVRGGTTTG
TNLTLNTETGKWDVVGFEKMYIK
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcctgtcgactctgagcctcgcagctctgtcggcgcctctggcgtctgcctca
tttgatgggaacatcaactacctcagcccttcccggcgccatgtcaaccttggcatcgac
gtcccggcagtcgcccgccgcagcatgaagcgcggcgccgtgccgtataagccatccgag
ttgaacttcactcacggtatcgcgtctggcgacccctatccggacagcgtcattctctgg
acccgcgtcgcgccgtccctggcttcagataacagcaatgtgaccgtcgagggaaccgtt
gacctgtacaatcacgagaccgaaaagtacgtcaaggcggatcctaacccaatttgcgtc
gaatggaaggtctgggaagcccaggagaaaggctcgaaacgtcctggtcacggcggatcc
gggaagcacattgtttcgcagggtactgcctacaccactagcgatattgactacactgtc
aaggtcgaggccaagggcctgaagccattcaccacctacaactaccaattcaacgtttgc
aagtccgataacgccagcccggtgggaaggacaaaaacggctccaagggagaatgctaag
ctggacgagatcaaccttgcggtgttctcgtgcagcaatttccccaatggctatttcaat
gcctacggcaacgcggcgcggaaggacaagcacgactacgtggtccacctaggtgactac
atatacgaaggagctcaggggggcgagcgtgcacacaacccgccacgcatcatctttagc
ctgtgggactataggacccgtcacggacagtaccgcactgatcccgatttgcagctcctg
tctcagaactatgcttggatgccgacgtgggatgatcatgaaattgccaacaacggttac
agggacggattcagcgcgctgaacaacaccgaagactccttccgcaaggacggcccgtcc
atcagcgtcgatcagcgtaagatgaacgccgtgcgggcctacttcgagtggatgcctatc
cgccaagtcgacctcgacgacaatcttcggatctggcggtccttcaaactgggccggctg
ctggacctgatcatccttgatacgcgcaactacgaccggagcatcactagcctgggctgg
aacgaccactacatcgacctgatccgtgacgacgcctcgcggtcgctgatgggctcgcgc
caggagcactggttctacaaccagctggccgagtcgtcgcggcggggggccgcctggcgc
gtcgtcggcagccaggtcatcttctcggacatcaacaacagcggcgacacgtggtcgggg
tacacggccaaccgcaaccgcacgctcaagcacctgtacgataacaagatcggcaacaac
gtcttcctcgccggcgacagccaccagaactgggtctcggacctggcctggctcggcgag
aagccgtacgactcccagaccggcgagggcgccgtgggcgtcgagttcgccggcaccgcc
gtcagctcgtccggccagagcggccccatcctggccgcgcgcgagaaggcccgccagcag
gtcgaggccaacgagctgatgcagtggcaggaggggtactaccgcggttacttcatcctc
aggatccgcgaggaagcggtaacggcgcagtattttggctcgcccagcgtggccaccccc
aatgcgtgggatctcccgctggccaacttcacgatcgcttcgggaaagaatcacctgacg
cgtccagtggccggtggcaacgtcgaggccgggttcgtccgcggcggcacgacgacgggc
acgaacctgacgctcaacacggagaccgggaagtgggacgttgttgggttcgagaagatg
tacatcaaataa

DBGET integrated database retrieval system