KEGG   Myceliophthora thermophila: MYCTH_2055311Help
Entry
MYCTH_2055311     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCTH_2055311
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCTH_2055311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(768990..769028,769190..769333,769414..769427,769518..772020)
Genome map
AA seq 899 aa AA seqDB search
MAGFFQKLKGAGSGVSKSDNTASAKSKKDEPQPDLTPLEKLLQNAGPIREDGSDKFFGLE
NFGNTCYCNSIVQALYHSEQFRRHVVNYPPPLPGDEGNRQRRKVNVTIRPPVQPEQSGNA
AGPSKPRQSFGGGPQLPPAVPPLRPEDKPDSPEYKKKQAMLRGPILELAQESVDPSGMEE
CTFTALRDIFQAMIESQSRTGVISPQRFLDIFKRNNEMFRNSMHQDAHEFYGIVLNDVIA
NVEAYAKRTQELADSTSKEDPSSHQAAGAIALTTTTMTTTTTTTNAGSVTRSSGTGWVHD
IFEGVLTSETRCLTCETASQRDETFLDLSIDLEEHSSVTACLLNFSAEEMLCERNKFHCD
HCGGLQEAEKRMKVKKLPKILALHLKRFKYTEDYSRLQKLFHRVVYPYHLRMFMTTDDAE
DPDRMYELYAVVVHIGGNAYHGHYVAVIKTKDRGWLLFDDEMVEPVDKHFVRNFFGDKPG
MACAYVLFYQETTFEKVREEMDAEGLDQVKLATQTADTAATTELPNGSSTALLSKLNSQP
LSPVDENETLATLDQARSAPPEIHVTTSTTSGGPPPPPLSASEVHPLVAAPPPGSAVATG
EDKGTAVTSKTKAQLAKEKKEAKAREKAEEKARKAAEKEQARLAAKERNEAQRRRIEAAR
LEREQLAQVLKESRRMAEEEEKRRRKEVGAITTTDTTTSSDAGAGGGGGGRGGDGDGGDE
QQHHRNGLFNRAGRTSKSMTRKSFAFLHIGQNKDEDKGDPKGYRTNRSEAGESGSVQGES
IPSSGAKENGAPSPYSHNKNGGGSNGNGNGTSTSTSTSIGGINGSPAKKPSNPFLARAIP
RSDTAPAGAVSQLRRTPDKHDREKDRDGKENQNQKPALKERFSFGLGRKKSSRFLSSAS
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggcggggttcttccagaagctcaaaggggccggatctggtgtctcaaaatccgataac
accgcatccgcaaaaagcaaaaaggacgaacctcagccagacctgacgccgctcgagaag
ctgttacaaaatgctggtccgatccgggaagacggcagcgacaaattctttgggttagaa
aacttcggcaatacatgttattgcaactcgattgttcaggcactatatcactcggagcag
ttccgacggcatgtcgtcaactaccccccgccgttacccggggacgaggggaacaggcag
aggcggaaggtcaatgttacaatacgacctccggtgcagccggagcagagcgggaatgcc
gccggcccgagtaagccgcggcagtccttcggcggaggaccgcagctccctcctgctgtc
ccacctttgcgcccggaggacaaaccggactcgccggagtacaagaagaagcaggccatg
ctgagggggccgatattagagctcgcgcaagagagcgtcgacccttccggcatggaggag
tgtacctttacggcactcagagacatcttccaggccatgatcgaaagtcagtccaggacg
ggcgtgataagcccgcagaggttcctggacatcttcaagcgtaacaacgagatgttccgc
aactcgatgcaccaggacgctcatgagttctacggcatagttctcaacgacgtgatcgcg
aacgtcgaggcttacgccaagaggacgcaagagctggcagacagcacaagcaaggaggat
ccgtcgtctcatcaggccgcaggcgcaatagccttgacgacgacgacgatgacgacgacc
accaccaccaccaatgccggttctgtgacgcggtcgtcggggaccggctgggtgcacgac
atcttcgagggcgtgctgacttcagaaaccaggtgcctgacctgcgagacggcatcacaa
cgcgacgagacgtttctagacttgtcaatcgacttggaggagcattcgtccgtgactgcg
tgcctgctcaacttctcggccgaggagatgctgtgcgagaggaacaagttccactgcgac
cactgcggcggcctgcaggaagcggaaaagcggatgaaggtcaagaaactgcccaagatt
ctcgcgttgcatctgaagcggttcaagtacaccgaggactacagccggttgcagaagctc
ttccatcgtgtcgtctacccctaccacctccggatgttcatgacgaccgacgacgccgaa
gatcccgacaggatgtacgagctctacgccgtggttgtgcatatcggagggaacgcgtac
cacgggcactacgtcgcggttatcaagaccaaagaccgtgggtggctactcttcgacgac
gagatggtcgagccggtggacaagcatttcgtccggaacttcttcggagacaagcccggg
atggcgtgcgcctacgtgctgttctaccaggagacgacgttcgagaaggtgcgggaagaa
atggatgccgaaggcctggaccaggtgaagctggccacccagacggcagacaccgcggcg
accacggagttgcctaacgggtcaagcaccgctctgctctcgaagctcaactcgcagccc
ctgtctccggtggacgagaacgaaacgctagccacgctcgatcaggccaggtcggcccct
cccgagatccacgtgaccacaagcaccacctcgggcggtccgccgccgcctcccctgtcc
gcttcggaagtccaccctctagtcgcagcgccaccccccggctcggccgtcgcgacagga
gaggacaagggcaccgctgttacgtcaaagaccaaggcgcaactagccaaggaaaagaag
gaagccaaggcgcgggagaaggccgaggagaaggcacggaaagccgccgaaaaggaacag
gctcgcctcgctgcgaaggagcgcaacgaggcgcaacgcaggcgaatagaggcggccagg
ctcgaacgcgagcagttagcccaggtgttaaaggagagcaggcggatggcggaagaggaa
gagaagcggcgcaggaaagaagtcggggcaataacgaccacggacacaaccacctcgtcc
gacgcgggtgctggcggcggcggcggcggacgcggcggcgatggcgatggtggcgacgag
cagcagcaccaccgaaacggtctgttcaaccgcgccggtcggacgagcaagtccatgacc
cgcaaaagcttcgccttcctgcacatcggccagaacaaggacgaggataagggcgacccg
aaggggtacagaaccaatcgcagcgaggcaggcgagagcgggagcgtccagggcgagagc
atcccgtcgtcgggcgccaaggagaacggggcgccctcgccctactcccacaacaagaac
ggcggcggtagcaacggcaacggcaacggcaccagcaccagcaccagcaccagcatcggc
ggcatcaacggatcgcccgccaaaaagccgagcaaccccttcctggcgcgggccatccca
cggtcggacacggcgcccgccggggcggtcagccagctgcgacgtactcccgacaagcac
gacagggagaaggatagagacggcaaggagaaccagaaccagaaaccggcgctcaaggag
aggttcagcttcgggctcggcaggaaaaagagcagcaggttcctgtcttcggcgtcctaa

DBGET integrated database retrieval system