KEGG   Myceliophthora thermophila: MYCTH_2067725Help
Entry
MYCTH_2067725     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mtm  Myceliophthora thermophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYCTH_2067725
Enzymes [BR:mtm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MYCTH_2067725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(3332329..3332930,3332987..3333263))
Genome map
AA seq 292 aa AA seqDB search
MAPKTPILFLKTKSSPGDTYEEFFTSPPDGASYEPSFVPVLKHQFDEAGIAIVRNALQSG
SISATAGSAYGGIIFTSQRAVEAFTKLVEERRGEDGWPHLQDVPIYSVGPATTRALKAVP
QVPPLQVFGEHTGAGDKLAPFILEHYGEWYKDREVKPPLLFLVGEKRRDVIPKVLTGAGW
RVDEVVIYGTGELESFYDDFARRLAETADRPTRWVVVFSPSGCDSMLRALDLLDASTGKA
KRKQPGRNTLIATIGPTTRDHLIQKFGFEPDICAEQPTPEGVWRGISSYRRR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaagacgccaatccttttcctaaaaaccaagtcgtcccctggtgacacctat
gaggagttcttcacatcgccgcctgatggcgccagctatgagccctccttcgttcctgtg
ctcaagcaccagttcgacgaagctgggatagccatcgtacgaaatgcgctccaaagcggg
tcgataagcgcaacagccggcagcgcctacggcggcattatctttacttcccagcgcgcc
gtcgaagccttcacgaagctcgtcgaggaaaggagaggtgaggatggctggcctcatctc
caggacgttcccatctatagcgtcgggccggccactacgcgcgccctcaaggctgttccc
caggtgcctcctctgcaggtgtttggagagcatacgggggcaggagacaaactggcccct
ttcatcctcgaacactatggggaatggtacaaggaccgcgaggttaagcctccgttgttg
ttcctagttggcgagaagcggcgggatgtcatccccaaagtgctaacaggggcaggatgg
cgggtggacgaagtggttatctacggtaccggggaattggagtcgttctacgacgacttc
gctcggcgcttggctgagacggcagatcgcccgacgagatgggtggttgtcttctcgccg
agcggttgtgacagtatgcttcgtgccctggacctcctggacgcgagcacgggcaaggcc
aagcgcaagcaacctggccggaacaccctgatcgccacgatcgggcctacaacccgtgat
catctaattcaaaagtttgggttcgagcccgacatctgcgctgagcagcccactccagaa
ggcgtctggcgtggcatttctagctaccgccgtcgatag

DBGET integrated database retrieval system