KEGG   Myceliophthora thermophila: MYCTH_2068493Help
Entry
MYCTH_2068493     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
mtm  Myceliophthora thermophila
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCTH_2068493
Enzymes [BR:mtm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MYCTH_2068493
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MYCTH_2068493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(1172804..1173839,1173925..1174133,1174218..1174421))
Genome map
AA seq 482 aa AA seqDB search
MSAVQEAPRKRTAYIALGSNMGDRIGWIEKACNEMDARGIRVKRTSSLWETEPMYVLDQD
RFVNGACEVETTLEPLELLDALQDIEKSLGRKKLIDKGPRNIDLDILLYDNIQFDHERLK
IPHVGIAEREFVLRPLAELIPDKPIDPSRPWRLTVDYLDALPPSKTPLTTMTPLSSHHPP
IQALNPSRKTHVMAILNMTPDSFSDGGQHKPIIPAQGAADDAGTTAADTAAARLKETIAG
FLDAGATMIDIGGQSTAPGTAEVPLEEELARVVPAVRLVREEFGSRPVLVSVDTYRAAVA
EAAVAAGADIVNDVSGGSMDPAMLPTVARLGATVCLMHMRGTPATMNGLAEYPAEQGGLI
GGIARELLARVRAAEEAGVRRWRIVLDPGLGFAKVGPQNVDVLRRLDELRSWPGLQGLPW
LVGSSRKSFIGRVTGVPTPKERIWGTAATVAAAVQGGADVVRVHDVREMAQVVAMADAIW
RY
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggtgcaggaagcgccgcgcaagcggacggcgtacatcgccttgggcagcaac
atgggcgaccgcatcggctggatcgagaaggcgtgcaacgagatggatgcgaggggcatc
agggtgaagcggacgagcagtctgtgggagacggagcccatgtacgtgctagaccaggat
agattcgtcaacggcgcctgcgaggtcgagacgaccttggagccgctcgagctcttggac
gcgcttcaagacatcgagaagtcgctgggccgcaagaagctcatcgacaaggggccccga
aacatcgatctcgacattctcctctacgataacatccagtttgaccatgagcgtctcaag
atccctcacgttggcatcgcagaacgtgaatttgtcctccgaccgctggccgaactcatc
cctgacaagccaattgacccctcccgcccctggcgtctgacggttgactacctcgacgcc
ctcccgccctccaagaccccgctcaccaccatgacgcccctctcttcgcaccacccgccc
atccaggcccttaacccgtcccgcaagacccacgtcatggccatcctcaacatgacgccg
gactccttctcggacggcggacagcacaagcccatcatccccgcccaaggcgctgctgac
gacgccggcaccaccgccgccgacaccgctgccgcccgcctcaaggagaccatcgccggc
ttcctggacgcgggcgcgaccatgatcgacatcggcgggcagtcgacggcccccgggacg
gccgaggtgccgctggaggaggagctggcgcgggtggtgccggcggtgcggctggtgcgg
gaggagttcgggtcgcggccggtgctcgtgtcggtggacacgtaccgggcggcggtggcg
gaggcggcggtggcggcgggggccgacatcgtcaacgacgtctcgggcgggtccatggac
ccggccatgctgcccaccgtcgcccgcctcggcgccaccgtctgcctcatgcacatgcgc
ggcaccccggccaccatgaacggcctggccgagtacccggccgagcagggcggcctgatc
ggcggcatcgcgcgcgagctgctcgcgcgcgtccgcgccgccgaggaggcgggcgtgcgg
cggtggcgcatcgtcctggaccccggcctcggcttcgccaaggtcggcccccagaacgtc
gacgtcctccgccgcctcgacgagctgaggagctggcccggcctgcagggcctgccgtgg
ctggtcgggtcgagccgcaagagcttcatcggcagggtgaccggggtgccgacgcccaag
gagaggatctggggaacggcggccacggttgccgcggctgtgcagggcggggcggatgtg
gtgagggtgcatgacgtgagggagatggctcaggtggtggcgatggcggacgccatctgg
aggtattag

DBGET integrated database retrieval system