KEGG   Myceliophthora thermophila: MYCTH_2079764Help
Entry
MYCTH_2079764     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MYCTH_2079764
    1.3.1.94  polyprenol reductase
     MYCTH_2079764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1938408..1938766,1938853..1939423))
Genome map
AA seq 309 aa AA seqDB search
MGWDGHWQYLLTTLSHATPAECCQAVFLLSAAGVLAVAVLPHDAKTLLVDYGARKARKPS
ADGRPQEVPNRGWLLSLIDTVTCWSQVPHSWFSSFYVVSLACSVFWLVQYLCDGAVLRCV
ADSQAAASQRSATLGQVALGWFMMFLQSARREFEHWTIIKPSKSTMWVVHWLLGFLFYFT
INLSVWVEGSHDAQSLLKMAAATPVFLFAWINQYWCHKHLAELKKYSLPTAGMFRHYICP
HYTCECLLYLSIAIATAPRGVWLNRTMVCALLFVATNLGVTAAGTRKWYGETFGIGSVAN
KWNMIPFIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggctgggacgggcattggcaatatcttcttacaactctctcccacgccacgcctgca
gaatgctgccaggctgtcttccttctttcggccgcaggtgtgcttgcagtggcggtgttg
ccgcatgatgcgaaaaccctcctcgttgattacggcgctcgcaaggcccggaagccctca
gcggatgggcgtccccaggaagttccgaaccgcggctggctactctcgctcattgacacc
gtcacatgttggtcgcaggtgccgcattcatggttcagctctttctatgtcgtgtctctg
gcatgttccgtattctggcttgttcagtacctctgtgatggggcagtattacgttgtgtg
gcggacagccaagctgccgcaagtcagcggtctgccacgttgggacaagtggcactaggc
tggttcatgatgttcctgcaaagcgccagacgagaatttgagcattggaccatcattaaa
ccgtccaaatcgactatgtgggtcgtgcactggttgctgggctttctcttctacttcacc
atcaacctatcggtctgggtggagggatctcacgatgcgcagtccctcttgaagatggcc
gcggcaaccccggtgttcctgttcgcttggatcaaccagtattggtgtcacaagcacctt
gccgaactgaagaagtattcgttaccgaccgctggcatgttccgacactacatctgtccg
cattatacttgcgagtgtcttctctacctttccatagccatcgcgacggcccctcgcggt
gtgtggttgaacaggacgatggtgtgcgccctcttgttcgtggcaaccaacctcggagta
accgcagcgggaacccgcaaatggtacggcgaaacgttcggcatcggctctgtcgcaaac
aagtggaatatgatcccattcatcttctag

DBGET integrated database retrieval system