KEGG   Myceliophthora thermophila: MYCTH_2080603Help
Entry
MYCTH_2080603     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCTH_2080603
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_2080603
   00020 Citrate cycle (TCA cycle)
    MYCTH_2080603
   00620 Pyruvate metabolism
    MYCTH_2080603
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MYCTH_2080603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(4534908..4535219,4535305..4536378)
Genome map
AA seq 461 aa AA seqDB search
MLVPAIRRQALQHARLARAVVPSLTRWYASYPPHTIVKMPALSPTMTSGNIGAWQKKVGE
LISPGEVLVEIETDKAQMDFEFQEEGVLAKILKETGEKDVAVGNPIAVLVEEGTDVSAFE
NFSLQDAGGEAAPAPAKKEEPKSESAPTPAPAPTPASEPEDTGLGGKLETALDREPNISA
AAKRLAIENGVPLKSLKGTGPGGKITEEDVKKALSTPAATATAAVSGASYEDIPISGMRK
TIASRLKESVSENPHYFVTSTVSVSKLLKLRQALNSSAEGKYKLSVNDFLIKAMAVACKK
VPAVNSSWRDGVIRQFNTVDVSVAVSTPSGLITPIVKGVEGKGLESISATVKELAKKARD
NKLKPEEYQGGTISISNMGMNPAVERFTAVINPPQAAILAVGSTKKVAVPAENEDGTTGV
EWDDQIVLTGSFDHKVIDGAVGAEWMRELKKVIENPLELLL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtccctgcgattcggaggcaagcgctgcagcatgccagacttgcacgcgctgtt
gttcccagcttaacaaggtggtatgcctcgtaccctccgcataccatcgtcaaaatgccg
gcgctgtcgccgaccatgacatcgggtaatattggcgcatggcagaagaaggttggcgaa
ttgatctcacccggcgaggtgctcgtcgagatcgagaccgataaagctcagatggacttt
gagttccaggaggagggtgttctggccaagatcctcaaggagaccggagagaaggacgtc
gcggtgggcaatccaattgccgttctcgtcgaggaagggaccgatgtgagcgcctttgag
aatttctcgctccaggatgctggcggtgaagctgctcccgcgccagcgaagaaagaagag
ccaaagtctgagtctgctccgaccccggccccggccccgacccctgcctccgagcccgag
gataccggacttggcggcaagctcgagaccgccctcgaccgcgagcccaacatttcggcc
gctgctaagagactcgccatcgagaatggcgtgccgctgaagagcttgaagggaactggt
cctggcggcaagatcaccgaggaggatgttaagaaggcgttgtccactcccgctgcaacc
gccactgccgccgtctcgggtgcttcgtacgaggacattcccatcagcggcatgcgcaag
accatcgcgtcgcgtctgaaggagtccgtctcggagaatccccactacttcgtcacctcg
accgtttccgtctccaagctgctgaagctccgtcaagccctgaacagcagcgccgagggc
aagtataagctctcagtcaatgacttcctcatcaaggccatggcggtggcttgcaagaag
gtcccggccgtcaacagctcttggcgcgatggtgtcatccgccagttcaacacagttgac
gtttcggttgccgtgtcgacccctagcggcctaatcacccccatcgtcaagggcgtcgag
ggcaagggcctcgagagcatctcggccaccgtcaaggagctcgctaaaaaggctcgcgac
aacaagctcaagcccgaggagtaccagggaggtaccattagcatctccaacatgggcatg
aaccccgccgttgagcgcttcaccgctgttatcaaccccccacaggcggccatcctggca
gtcggcagcacaaagaaggtcgctgtcccggctgagaacgaggatggcacgaccggtgtt
gagtgggatgaccagattgttctcactggcagcttcgatcacaaggtcattgacggtgcg
gttggtgccgagtggatgcgcgagcttaagaaggttatcgagaaccctcttgagctactt
ctctag

DBGET integrated database retrieval system