KEGG   Myceliophthora thermophila: MYCTH_2082283Help
Entry
MYCTH_2082283     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_2082283
   00052 Galactose metabolism
    MYCTH_2082283
Enzymes [BR:mtm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MYCTH_2082283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(1215658..1216159,1216219..1216742))
Genome map
AA seq 341 aa AA seqDB search
MADAPVTLLPLGAIIQEFRIGGLNIVQGFPEQSHYESYNAPYFGETIGRVANRIKGAQVD
SLNGGRSYKLAANNGPNNLHGGVVGWGKKIWNGPTPVGVRQIPGIEGLDGGESVKFSLVS
QDGDEGFPGTVEASVVYTVGKQVQDGKEVLVLGFEYEAELVDGADETVINMTNHSYFNLT
GGPSIEGTVVTLATNSYLPVDDGGIPTAGPKPFGKVEVTKPFTLGAQEPDIDDCFIVNEA
SNTIPIDTRSNPLTKLVSAHHPESKIHLEVLSTEPAFQFYTGKYIDVPEVAGVPPRKARS
GFCVEPSRWVNACNVDEWKSQMLLKKGEKYGARIVYRAWKE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcacccgttacccttctgcccctgggagctatcattcaggagttccgcatc
ggcggcctcaacatcgttcaaggatttcccgagcagtcccactacgagagctacaatgcc
ccctacttcggcgagactatcggtcgtgtggccaaccgcatcaagggcgcccaggttgac
tccttgaacggcggacggtcctacaagctggcggctaacaacggcccgaacaatctgcac
ggcggcgtggtcggctggggcaagaagatctggaacgggcccacgcccgtcggcgtgagg
cagattcccggcatcgagggcctcgacggcggcgagagcgtcaagttctcgctggtcagc
caggatggagatgaaggctttccggggacagtggaggccagcgtggtgtataccgtcggc
aagcaggtgcaggacgggaaagaggtcttggtgctcgggttcgagtacgaggcggagctg
gttgacggtgccgacgagacggtcatcaacatgacgaaccattcctacttcaatctcact
ggcggcccgtccatcgaagggaccgtcgtcaccctcgccaccaacagctaccttcccgtc
gacgacggcggcatcccgacggccggcccgaagccgttcggcaaggtggaggtcaccaag
cctttcacgctgggcgcccaagagccggacattgacgactgcttcattgtcaacgaggcg
tccaacacgatcccgatcgacacccgttcgaaccccctgaccaaactcgtcagtgcacac
caccccgagtccaagatccaccttgaggtgctgagcacggagccggcgtttcagttctac
acgggcaagtacatcgacgtgcccgaggtcgccggtgtgcccccgcgcaaggctcgcagc
ggtttctgcgtcgagccgagccggtgggtcaatgcgtgcaacgttgacgagtggaagagc
cagatgctactcaagaagggcgagaagtacggcgcccgcatcgtgtaccgggcatggaag
gagtag

DBGET integrated database retrieval system