KEGG   Thermothelomyces thermophila: MYCTH_2082283Help
Entry
MYCTH_2082283     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00010  Glycolysis / Gluconeogenesis
mtm00052  Galactose metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
Module
mtm_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_2082283
   00052 Galactose metabolism
    MYCTH_2082283
Enzymes [BR:mtm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MYCTH_2082283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 11506908
NCBI-ProteinID: XP_003664958
JGI: 2082283
UniProt: G2QJF6
Position
5:complement(join(1215658..1216159,1216219..1216742))
Genome map
AA seq 341 aa AA seqDB search
MADAPVTLLPLGAIIQEFRIGGLNIVQGFPEQSHYESYNAPYFGETIGRVANRIKGAQVD
SLNGGRSYKLAANNGPNNLHGGVVGWGKKIWNGPTPVGVRQIPGIEGLDGGESVKFSLVS
QDGDEGFPGTVEASVVYTVGKQVQDGKEVLVLGFEYEAELVDGADETVINMTNHSYFNLT
GGPSIEGTVVTLATNSYLPVDDGGIPTAGPKPFGKVEVTKPFTLGAQEPDIDDCFIVNEA
SNTIPIDTRSNPLTKLVSAHHPESKIHLEVLSTEPAFQFYTGKYIDVPEVAGVPPRKARS
GFCVEPSRWVNACNVDEWKSQMLLKKGEKYGARIVYRAWKE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcacccgttacccttctgcccctgggagctatcattcaggagttccgcatc
ggcggcctcaacatcgttcaaggatttcccgagcagtcccactacgagagctacaatgcc
ccctacttcggcgagactatcggtcgtgtggccaaccgcatcaagggcgcccaggttgac
tccttgaacggcggacggtcctacaagctggcggctaacaacggcccgaacaatctgcac
ggcggcgtggtcggctggggcaagaagatctggaacgggcccacgcccgtcggcgtgagg
cagattcccggcatcgagggcctcgacggcggcgagagcgtcaagttctcgctggtcagc
caggatggagatgaaggctttccggggacagtggaggccagcgtggtgtataccgtcggc
aagcaggtgcaggacgggaaagaggtcttggtgctcgggttcgagtacgaggcggagctg
gttgacggtgccgacgagacggtcatcaacatgacgaaccattcctacttcaatctcact
ggcggcccgtccatcgaagggaccgtcgtcaccctcgccaccaacagctaccttcccgtc
gacgacggcggcatcccgacggccggcccgaagccgttcggcaaggtggaggtcaccaag
cctttcacgctgggcgcccaagagccggacattgacgactgcttcattgtcaacgaggcg
tccaacacgatcccgatcgacacccgttcgaaccccctgaccaaactcgtcagtgcacac
caccccgagtccaagatccaccttgaggtgctgagcacggagccggcgtttcagttctac
acgggcaagtacatcgacgtgcccgaggtcgccggtgtgcccccgcgcaaggctcgcagc
ggtttctgcgtcgagccgagccggtgggtcaatgcgtgcaacgttgacgagtggaagagc
cagatgctactcaagaagggcgagaagtacggcgcccgcatcgtgtaccgggcatggaag
gagtag

DBGET integrated database retrieval system