KEGG   Myceliophthora thermophila: MYCTH_2082917Help
Entry
MYCTH_2082917     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mtm  Myceliophthora thermophila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCTH_2082917
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCTH_2082917
  Amino acid metabolism
   00310 Lysine degradation
    MYCTH_2082917
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MYCTH_2082917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(3251943..3252239,3252298..3252690,3252751..3253119,3253182..3253424))
Genome map
AA seq 433 aa AA seqDB search
MLYRGLRLAARTAPRFSLSSTSSALRQLPLQFQHVRTYADTIVKVPTMAESISEGTLKQW
NKSIGDFVEQDEEIATIETDKIDVAVNAPEAGIIKEFLANEEDTVTVGQDLVRIELGGAP
SGDKPAATEAKETPKETPKETPKEPAPEKQTEQKNAPEPKPQETKPATPSAPAKEESAAP
KQPAKPAKATTEAPATLGSREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSALI
EFRNKYKDEVLKKTGVKLGFMSAFSRACVLAMRDIPVVNASIEGPNGGDTIVYRDYVDIS
VAVATEKGLVTPVVRNVETMDMIEIEKAIAEMGKKARDGKLTIEDMAGGTFTISNGGVFG
SLMGTPIINLPQSAVLGLHAIKDRPVAVNGKVEIRPMMYLALTYDHRLLDGREAVQFLVK
VKEYIEDPRKMLL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccgaggacttcggctcgcggctcgtaccgctcctagattttcgctctccagc
acgagctcagcactacgccaactccctctgcaatttcagcatgtacggacctacgccgat
acgattgtcaaggtgccgacgatggccgagtcgatcagcgagggcaccttgaaacagtgg
aacaagtctattggcgactttgttgagcaggatgaggagattgcaacgattgaaacggac
aagatcgatgttgccgtgaacgcaccagaagccggcatcattaaagagttcttggccaat
gaggaagacactgtcactgtcggccaggatttggtgcgcattgagctcggtggcgcgccg
tcgggcgataagccggccgcgacggaggccaaagagacgcctaaggagacgcctaaggag
acgcccaaggagccagcacccgagaaacagacggagcaaaagaatgcgccagagcccaag
ccgcaggaaacgaagccggctactccatctgccccggcgaaggaagagtcggctgcgccg
aagcagccggccaaaccggcaaaagccaccaccgaagctcctgccactctgggtagccgg
gaagaaaggagggtgaagatgaaccggatgcgtctccgcatcgcggagcgcctcaagcag
tcccagaatactgctgcctcgctgaccacattcaacgaggtcgacatgtcggccctgatt
gagttccgcaataagtacaaggatgaggtcctgaagaagacgggcgtgaagctgggcttc
atgagcgccttctctcgcgcttgcgttctcgctatgcgcgatatcccggtagttaatgcg
tcaatcgagggccccaatggtggcgacaccatcgtctatagggactacgtcgatatcagc
gttgccgtcgcaacagagaagggccttgttacccccgttgtacgcaacgtagagaccatg
gacatgattgagatcgagaaggctattgccgagatgggcaagaaggctcgtgatggcaaa
cttacgattgaggatatggctggcggtactttcaccatcagtaacggaggggttttcggt
tcccttatgggcactcctatcattaacctgccacagagtgcggtgctcggcctccacgcc
atcaaggatcgccccgtggccgttaacggcaaagtggagatccgcccgatgatgtacctt
gccctcacctacgatcaccgtctgctggatggcagggaggcggtgcagttcctggtcaag
gttaaggagtacattgaggacccccgcaaaatgctcctttag

DBGET integrated database retrieval system