KEGG   Myceliophthora thermophila: MYCTH_2095610Help
Entry
MYCTH_2095610     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MYCTH_2095610
Protein kinases [BR:mtm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MYCTH_2095610
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MYCTH_2095610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(3328429..3328535,3328598..3328793,3328853..3329234,3329304..3329680)
Genome map
AA seq 353 aa AA seqDB search
MSNVQNRGGARKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSMF
CLRTLREMKLLRYFNHENIISILDIQKPRSYETFNEVYLIQELMETDMHRVIRTQELSDD
HCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSGFM
TEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVL
GTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPNTSELALDLLEKLLAFNPVKRITV
EEALKHPYLEPYHDPDDEPTAPPIPEEFFDFDKHKDNLTKEQLKQLIYQEIMR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgtacagaacagaggcggggcgcgcaagatctcgttcaatgtcagcgagcag
tatgacatccaggacgtggtcggcgaaggtgcctatggcgtcgtgtgctccgctatccac
aaaccttctggccagaaggttgccatcaagaagatcacgccatttgaccactccatgttc
tgcttgcggacgctccgtgagatgaagctcctacggtacttcaaccacgagaacatcatc
tcaattctggacatccagaagcctcggagttacgagactttcaacgaggtttacctgatc
caggaactcatggagaccgacatgcatcgcgtcatccgcacacaagagctctcggacgat
cactgccagtacttcatctaccagacgttgcgggcgctaaaggcgatgcactcggcaaac
gtgctacaccgagacctcaagccatccaacctgcttctcaacgctaactgcgacctgaaa
gtctgcgactttggcttggcacggtcggccgcgtcgcaggaggacaactcgggtttcatg
acggaatatgtggccactcgctggtaccgtgctcccgagatcatgttgaccttcaaggag
tacaccaaggcaatcgatgtctggtcggtgggctgcatcttggccgagatgctgagcggc
aagcccctgttcccgggaaaggactaccaccaccagctcaccctgatcctggacgtcctg
ggcacaccaacaatggaggactactacggcatcaagtcgcgccgcgcgcgcgagtacatc
cgctcgttgccattcaagaaaaaggtgccattccggacgctgtttcccaacacatccgaa
ctggctcttgatcttctagaaaagctgctcgctttcaatccggtcaagcgcatcacggtc
gaagaggcgctcaagcacccctacctcgaaccatatcacgacccggatgatgagccgacg
gcaccgcctatccccgaggagttcttcgactttgacaagcacaaggataatctcaccaag
gagcagttgaaacagctgatttatcaggaaatcatgaggtag

DBGET integrated database retrieval system