KEGG   Myceliophthora thermophila: MYCTH_2097501Help
Entry
MYCTH_2097501     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCTH_2097501
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_2097501
   00620 Pyruvate metabolism
    MYCTH_2097501
   00640 Propanoate metabolism
    MYCTH_2097501
  Energy metabolism
   00680 Methane metabolism
    MYCTH_2097501
Enzymes [BR:mtm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MYCTH_2097501
Lipid biosynthesis proteins [BR:mtm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MYCTH_2097501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:join(2117041..2117101,2117205..2117228,2117328..2117354,2117476..2118638,2118707..2118967,2119062..2119466,2119540..2119602)
Genome map
AA seq 667 aa AA seqDB search
MAQDAAKAPVVAEAHEVDTYHPPKKMLEKHPSKPHLSGLEEYQRLYKESITEPDKFWGRL
ARELLTWHKDFQTVRSGSLVNGDVAWFLEGEINASYNCIDRHAFKDPNRVAIIYEADEPT
DGRTVTYGELLREVSRVAYVLKSLGVRKGDTVAIYLPMIPEAVIAILACARIGAVHSVVF
AGFSADSLRDRVLDARSRVVITADEGKRGGKLIGTKKIVDDALRQCPDVTGVLVFKRTGA
DIPMTKGRDVWWHEEVEKWPAYMAPERMSAEDPLFLLYTSGSTGKPKGMMHTTGGYLVGA
AATGKYVFDIHDGDRFFCGGDVGWITGHTYVVYAPLLLGVSTVVFEGTPAYPNFSRYWDI
IEKHKVTQFYVAPTALRLLKRAGDQHVRNEMKHLRVLGSVGEPIAAEVWKWYFEVVGKEE
SQIVDTYWQTETGSHVIAPLAGVTPTKPGSASLPFFGIEPAIIDPVSGEEIHGNDVEGVL
AFKQPWPSMARTVWGAHKRYMETYLNVYKGYYFTGDGAGRDHEGFYWIRGRVDDVVNVSG
HRLSTAEIEAALIEHAAVAEAAVVGVADELTGQAVNAFVSIKDGNEPSDALRKEFILQVR
RSIGPFAAPKAVYIVPDLPKTRSGKIMRRILRKILAGEEDQLGDITTLSDPSVVEKIINA
VHEAKKK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagacgctgccaaggcccccgtggtggccgaggctcatgaagtcgacacctac
catcccccgaagaagatgctcgagaagcacccaagcaagcctcatctgagcggtctcgag
gaataccagcggctgtacaaggagtccatcacagagcccgacaagttctgggggagactg
gcccgcgagctgctcacctggcacaaggatttccagacggtgaggagcggctctctcgtc
aacggtgacgtcgcttggttcctcgagggcgagatcaacgcctcgtacaactgcatcgat
cgccatgccttcaaggatcccaaccgcgtcgccatcatttacgaggccgacgagccgacc
gatggccggaccgtgacctatggcgagctcctgcgcgaggtttcgcgcgtcgcctacgtc
ctcaagagcctgggcgtgcgcaagggcgacaccgtcgccatctacctgcccatgattccc
gaggcggtcatcgccatcctcgcctgcgccaggatcggcgccgtccactcggttgtcttc
gccggcttctcggcggactcgttgcgcgaccgcgtcctcgacgctcgctcgcgggtcgtc
ataaccgcggacgagggcaagcgtggcggaaagctgatcggcaccaagaagatcgtggac
gacgccctccggcagtgccccgacgtcacgggcgtcctcgtcttcaagcgcaccggcgcc
gacatccccatgaccaagggccgcgatgtctggtggcacgaggaggtcgagaagtggccc
gcgtacatggcgcccgagcgcatgagcgccgaggacccgctcttcctcctctacacatcc
ggctcgaccggcaagcccaagggcatgatgcacacgaccggtggttacctcgtcggcgcc
gcggccacgggcaagtacgtcttcgacatccacgacggcgaccgcttcttctgcggcggc
gacgtcggctggatcaccggtcatacctatgtcgtctacgcccccctgctcctcggcgtc
tcgacggtcgtcttcgagggcacgccggcctatcccaacttctcgcgttactgggacatc
atcgagaagcacaaggtgacgcagttctacgtcgccccgaccgccctgcgcttgctcaag
cgcgccggtgaccagcatgtgcgcaacgagatgaaacacctccgcgtgctcggctccgtt
ggcgaacccatcgccgcagaggtctggaagtggtacttcgaagtggtcggcaaggaggag
tcccagattgtcgacacatactggcaaaccgagaccggctcgcacgtcatcgctccgctg
gccggtgtgacgccgacgaagcccggctccgcctctctcccgttctttggcatcgagccc
gccatcatcgaccccgtctcgggcgaggaaatccacggcaacgatgtcgagggcgtcttg
gccttcaagcagccgtggccaagcatggcccggaccgtctggggcgcccacaagcgttat
atggagacgtacctcaatgtttacaagggctactatttcaccggtgatggtgccggccgg
gatcacgagggcttctactggatccggggccgtgtcgacgacgtcgtgaacgtcagcggc
caccgtctgtcgaccgccgagatcgaagctgccctcattgagcacgccgccgttgccgag
gccgctgtcgtcggcgtcgcggacgagctcacgggccaggctgtcaacgctttcgtctcc
atcaaggacggcaacgagccgtctgatgctctccgcaaggagttcatccttcaggtccgc
aggagcatcgggccgttcgcagctcccaaggctgtgtacatcgtccccgacttgcccaag
acgcgcagcggcaagatcatgaggcgcattctgaggaagattctcgctggcgaggaggac
caactcggcgacattaccacgctctcggatccttctgtcgtcgagaagatcatcaacgct
gtccacgaggccaagaagaaataa

DBGET integrated database retrieval system