KEGG   Myceliophthora thermophila: MYCTH_2119446Help
Entry
MYCTH_2119446     CDS       T02231                                 

Definition
glycoside hydrolase family 27 protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mtm  Myceliophthora thermophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MYCTH_2119446
  Lipid metabolism
   00561 Glycerolipid metabolism
    MYCTH_2119446
   00600 Sphingolipid metabolism
    MYCTH_2119446
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    MYCTH_2119446
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MYCTH_2119446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(3253099..3253136,3253175..3254206,3254343..3254406,3254472..3254566,3254660..3254717))
Genome map
AA seq 428 aa AA seqDB search
MGTAALNDGVGKLPALGFNTWNLYQCNYTADVLLEQAQAIVDRGLLKAGYNYFMLDDCYS
LKERDENGRIVEDPEKFPNGMKNFTESLAKLGFRAGIYSDAGYRTCGGYPGSYGNEAKDL
ETFAEWGFEYLKYDNCYIPFDNVTQENVYGRYERMAEAIRARAEETDSAPLQLALCEWGW
QQPWRWAGRLGQSWRIGGDIRPWWSALSSIINQASFIAGATGFYARNDLDMLEVGNTGIG
TPPGNLSYDEAKSHFTAWALLKSPLLIGSDMASASRETMEILGNEDILRINQDPHVGEAV
APFRWGHNADYTWDPDHPAEYWTGNSSYGVVFMVLNTFDEPRHMSFNLTESWAIRAGRLY
SVYDLWTHTDNGTAYRNISLTLPPHGVAALLLNDAGPEPEAAEPYCAVWWQCSYPNVLVV
DDDDGWHG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgcagctctaaatgatggagtaggaaagctccccgcccttgggttcaacact
tggaacctgtaccagtgtaattacactgccgacgtcttgctggagcaggcccaggcaata
gttgatcgcggccttttgaaggccggatacaattactttatgcttgatgactgctactcc
ttgaaggagagggacgagaatggcaggattgtcgaagacccggaaaagttcccgaatggc
atgaagaacttcaccgagtcgctggccaagctgggcttccgggcgggcatctacagcgac
gcgggctaccgcacttgcggaggctatccgggctcgtacggcaatgaggccaaggacctc
gagacgtttgccgagtgggggttcgagtatctcaagtacgacaattgctacatccccttc
gacaacgtgacgcaggagaacgtgtacgggcggtacgagcggatggcggaggcgatccgg
gcgcgggccgaggagacggactcggcgccgttgcagctggccctctgcgaatgggggtgg
cagcagccgtggcggtgggcggggcggctgggccagtcgtggcggatcgggggcgacatc
cggccgtggtggtcggcgctgtcgagcatcatcaaccaggcgagcttcatcgcgggcgcg
acgggcttctacgcgcgcaacgacctcgacatgctcgaggtgggcaacacgggcatcggg
acgccgccgggcaacctcagctacgacgaggcaaagtcgcacttcaccgcctgggcgctc
ctaaagtcgcccctgctgatcggctccgatatggcctctgcctcccgcgagacgatggag
atcctcggcaacgaggacatcctccgcatcaaccaggacccgcacgtcggcgaggccgtc
gccccgttccgctggggccacaacgccgactacacctgggacccggaccacccggccgaa
tactggacggggaactcgtcgtacggcgtcgtcttcatggtcctcaacactttcgacgag
ccccgccacatgtccttcaacctgaccgagagctgggccatccgggccgggcggctctac
tcggtctatgacctgtggacgcacaccgataacgggacggcctaccgcaacatctcgctc
accctgcccccgcacggcgtggccgcgctgctgctgaacgacgccggcccggaacccgag
gctgccgagccgtactgcgccgtgtggtggcagtgctcgtatccgaatgtcctagtcgtc
gacgatgacgacggatggcacggctga

DBGET integrated database retrieval system