KEGG   Myceliophthora thermophila: MYCTH_2124177Help
Entry
MYCTH_2124177     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
mtm  Myceliophthora thermophila
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MYCTH_2124177
   03420 Nucleotide excision repair
    MYCTH_2124177
   03430 Mismatch repair
    MYCTH_2124177
   03440 Homologous recombination
    MYCTH_2124177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(8722604..8722621,8722770..8723031,8723107..8723219,8723324..8724043)
Genome map
AA seq 370 aa AA seqDB search
MLFPSKTWTACPTWVVQVVVASELCESGNEQVSAPYQPQDPTRSICLRGTRKVLAAQARR
SASCTCHLAPRHLATHSTPIGSHPAYTGRLLIMTSYGGYQRTGYGAQGGEDGGGFMGASQ
QGSQGGGSGGKADDTLRPVTIKQLIDCKEAYPGAELAVDGVPTTQVTLVGQVRSVAPQAI
NVVYRLDDGTGVIDVKKWIDAEKPDSVQQFAPGTYVRVFGRLQSFNNKRQVSAHYIRAIE
DFNEVNYHLLEATYVHLALTKGPAGGAGQQHQDDGGDSMFVDGGYGAAGGGGDGGGSVAM
QARLGSCSRNAKTVFNYLANAPGTDGVHLNQVASGTGLSAKDIMAATEELLGQGLIYTTQ
DDETWAILDY
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctgttcccttcaaagacctggaccgcctgcccgacctgggtggtccaagttgtagtt
gcgtcagagctgtgcgaatcagggaacgaacaagttagtgcgccttatcagcctcaggac
cccacacgcagcatctgcctgcggggcacgcgtaaagtgcttgctgcccaggcgcgtcgc
agcgcgtcttgcacttgccatcttgccccccgccatcttgcaacacactcgacacccatc
ggatcccatccagcatatacaggcagactacttatcatgacatcgtacggcggctaccaa
cgaacgggctacggcgcccaaggcggcgaagatggcggcggtttcatgggcgcatcgcag
caaggaagccaagggggcggcagcggaggaaaggcggacgacaccctccgcccagtaacc
atcaaacaattgatcgactgcaaagaagcttatccgggcgccgagctggccgtggacggc
gtgccgaccacccaggtgactctcgtcggtcaggtgcgctcggtggctccgcaggcgatc
aacgtcgtgtaccgcctcgacgacggcaccggcgtgatcgacgtcaagaagtggatcgac
gccgagaagcccgattccgtgcagcagttcgccccgggcacgtacgtgcgcgtgttcggc
cgcctgcagagcttcaacaacaagcgccaggtcagcgctcactacatccgcgccatcgag
gacttcaacgaggtcaactatcacctgctcgaggcgacgtatgtgcacctggccctgacc
aagggcccggccgggggcgccgggcagcagcaccaggacgacggcggcgacagcatgttt
gtggacggcgggtacggggccgccggcggcggcggcgacgggggcggctcggtggcgatg
caggcgaggctggggtcgtgctcgaggaacgcgaagaccgtcttcaactacttggccaac
gcacccgggaccgacggtgtgcacctcaaccaagtcgcgtcggggacgggcttgtcggca
aaggatatcatggctgctacggaggagctgctgggtcagggcctcatctacaccacgcaa
gacgatgagacgtgggctatcctggattactaa

DBGET integrated database retrieval system