KEGG   Myceliophthora thermophila: MYCTH_2133010Help
Entry
MYCTH_2133010     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
mtm  Myceliophthora thermophila
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MYCTH_2133010
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     MYCTH_2133010
Protein kinases [BR:mtm01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   MYCTH_2133010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(494021..494112,494166..494349,494406..494937,494996..495153,495214..495498))
Genome map
AA seq 416 aa AA seqDB search
MADAFAPRSMKRKNVKGLALKAPAPKPPPTAESAARMGAGNGRGDDNTAQLEIGIEFNLD
LKPEDLEIIRDLGAGNGGTVSKVRHIPTNTVMARKIIHVEAKKEMRKRIVRELQIMHGCH
SDYIVTFYGAFLNENNDVIMCMEYMDVGSLDRISRVFGPVRVDVLGKIAEATLGGLTYLY
SKHHIMHRDIKPSNILVNSRGSIKLCDFGVSGELINSVADTFVGTSTYMAPERIQGERYT
VKSDVWSFGLTIMELAIGKFPFAASEQLSDAESAPAGILDLLQQIVHEPAPRLPKSDAFP
QILEDMIQKCLYKEPERRPTPQELYDHDLFVQAAKRTPVDLREWACSLMDRDNRKSHLAP
QPSPATQELLRSSDSPTYATQQTPTASYRVDPRQAADHANLAAQVDRLYIREWDHE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcctttgccccgcgctccatgaagcgcaaaaatgtcaaagggctcgccttg
aaggcacccgctccgaaaccccctccgacggccgagagtgccgcccgtatgggcgccgga
aatggaaggggagatgataacaccgcgcagctggaaatcgggattgagttcaacctggat
ctgaagcccgaggatcttgagatcatcagggatctaggtgctgggaatggtgggactgtc
agcaaagtcaggcacatcccgaccaacacggtcatggcgcggaagatcatccatgtcgag
gcgaagaaggagatgcggaagcgcatagtcagggagttgcagatcatgcatggatgccat
tccgactacatcgttaccttctacggggctttccttaacgagaacaacgacgtaatcatg
tgcatggagtacatggacgttggctctctcgaccgcatttcaagggtattcggtcctgtc
cgcgtagatgtcctgggcaagatagccgaagcgactctgggcggcctcacatatctctat
tcgaagcatcatatcatgcaccgcgacatcaagccttctaatatcctcgtcaactcacgg
ggttccatcaagctctgcgactttggcgtctcgggagagctcatcaactccgttgccgac
accttcgtgggcacctccacatacatggctccggagcggatccaaggcgagaggtatacg
gtgaagtcggatgtgtggagctttggccttaccatcatggaactagctatcggcaaattc
ccatttgccgcgagcgagcagttgtcagatgcggagagtgcaccagccggtatcctcgat
ctgctacagcaaatcgtgcatgagccggcgcctcgactgcctaagagcgatgccttcccg
cagatcctcgaagacatgatccagaaatgtctttacaaggagcctgagcggcggccaacg
ccgcaggagctttatgatcacgacctcttcgtacaggctgccaaaagaacccccgttgac
ctgagagagtgggcatgcagcttgatggacagggacaaccgcaaatctcacctggcccct
cagccttcgcccgcgactcaggaactcctgcgttccagtgactcccccacatacgcgacc
cagcagacaccaacagcatcataccgggtcgacccacggcaggcggccgaccacgccaat
ctagcagcccaggtggatcgcctgtacatccgcgaatgggaccacgaatga

DBGET integrated database retrieval system