KEGG   Myceliophthora thermophila: MYCTH_2133010Help
Entry
MYCTH_2133010     CDS       T02231                                 

Definition
hypothetical protein
Organism
mtm  Myceliophthora thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(494021..494112,494166..494349,494406..494937,494996..495153,495214..495498))
Genome map
AA seq 416 aa AA seqDB search
MADAFAPRSMKRKNVKGLALKAPAPKPPPTAESAARMGAGNGRGDDNTAQLEIGIEFNLD
LKPEDLEIIRDLGAGNGGTVSKVRHIPTNTVMARKIIHVEAKKEMRKRIVRELQIMHGCH
SDYIVTFYGAFLNENNDVIMCMEYMDVGSLDRISRVFGPVRVDVLGKIAEATLGGLTYLY
SKHHIMHRDIKPSNILVNSRGSIKLCDFGVSGELINSVADTFVGTSTYMAPERIQGERYT
VKSDVWSFGLTIMELAIGKFPFAASEQLSDAESAPAGILDLLQQIVHEPAPRLPKSDAFP
QILEDMIQKCLYKEPERRPTPQELYDHDLFVQAAKRTPVDLREWACSLMDRDNRKSHLAP
QPSPATQELLRSSDSPTYATQQTPTASYRVDPRQAADHANLAAQVDRLYIREWDHE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcctttgccccgcgctccatgaagcgcaaaaatgtcaaagggctcgccttg
aaggcacccgctccgaaaccccctccgacggccgagagtgccgcccgtatgggcgccgga
aatggaaggggagatgataacaccgcgcagctggaaatcgggattgagttcaacctggat
ctgaagcccgaggatcttgagatcatcagggatctaggtgctgggaatggtgggactgtc
agcaaagtcaggcacatcccgaccaacacggtcatggcgcggaagatcatccatgtcgag
gcgaagaaggagatgcggaagcgcatagtcagggagttgcagatcatgcatggatgccat
tccgactacatcgttaccttctacggggctttccttaacgagaacaacgacgtaatcatg
tgcatggagtacatggacgttggctctctcgaccgcatttcaagggtattcggtcctgtc
cgcgtagatgtcctgggcaagatagccgaagcgactctgggcggcctcacatatctctat
tcgaagcatcatatcatgcaccgcgacatcaagccttctaatatcctcgtcaactcacgg
ggttccatcaagctctgcgactttggcgtctcgggagagctcatcaactccgttgccgac
accttcgtgggcacctccacatacatggctccggagcggatccaaggcgagaggtatacg
gtgaagtcggatgtgtggagctttggccttaccatcatggaactagctatcggcaaattc
ccatttgccgcgagcgagcagttgtcagatgcggagagtgcaccagccggtatcctcgat
ctgctacagcaaatcgtgcatgagccggcgcctcgactgcctaagagcgatgccttcccg
cagatcctcgaagacatgatccagaaatgtctttacaaggagcctgagcggcggccaacg
ccgcaggagctttatgatcacgacctcttcgtacaggctgccaaaagaacccccgttgac
ctgagagagtgggcatgcagcttgatggacagggacaaccgcaaatctcacctggcccct
cagccttcgcccgcgactcaggaactcctgcgttccagtgactcccccacatacgcgacc
cagcagacaccaacagcatcataccgggtcgacccacggcaggcggccgaccacgccaat
ctagcagcccaggtggatcgcctgtacatccgcgaatgggaccacgaatga

DBGET integrated database retrieval system