KEGG   Myceliophthora thermophila: MYCTH_2138498Help
Entry
MYCTH_2138498     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCTH_2138498
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MYCTH_2138498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(4144054..4144133,4144243..4144314,4144437..4145040,4145103..4145286,4146833..4147009,4147171..4148771,4148825..4148836,4148898..4148975))
Genome map
AA seq 935 aa AA seqDB search
MATSQTKAAVAASIGLRALSYVFLRWSLVPVLPAIVFTLFALYLPAFVLGYRKEPKHVLV
DRVDVVVTETTVEGKGTPNNGDSRRSHGDREVVAEDVSVKETISVEDRPLNPWKTLLTGA
PNPRSLALSLATLLLNGLCVGLVADRLFRERSYTVDDLSFVRVGYVSENEAKLLIREPDQ
SKMPITVEVHIKDPQPPFDNPLWQNAGGVRWTAEETDYTAVVSIPLRHSKKRTYEWRTSN
NHSGEFTAPPPIGHAEETNYGPFTFLSTSCIIPRFPYNPLDHPLSIPGLRHLARVLPTLN
AQFMLFLGDFIYADVPRYWDKSVGYYRQKYRQVYASPDWPAVGQNLSWIHALDDHEIFND
WSANLTGVYTSAIDPFHHYHAAANPPRARRASAFAARAPNATYFEFTQGPASFFLLDTRS
FRSSNTLLPATATDKTMLGADQLADLLAWLRRPEPRGVKWKIVASSVPFTKNWPVNTRDT
WGGFLAERAVVLEAMWDAASRGLGVVVLSGDRHEFAATKFPPPDGDPRWPETATVWEFSA
SPLNQFYSPFPTYRQTDRDDVMVKYIYKGNSKFGAITIENMEGSDQSSLKYRLFIDGEEV
WNTVVLSPPPAKVDRSTGSFWGRSVYRWDFLRHYMYYDHRADKPMREYWGDEIQMRPPEV
DYDVVMEDDNDDHGVALLTDKIASRTYGFCFVRHTPYEDPDDTRKLLERIAFIRQTHYGG
FYDFKPDLAMADTAYTNQALPPHTDTTYFTDPAGLQAFHMLSHERGPDGERPYGGASVLV
DGFKAARVLHDEDREAYNVLKKVRLPWHASGNKGITIRPDVNYPVFETHSSLGLYRIRWN
NDDRGVVPFDKVRPEVWYRAAAKWNEIINRPRLQYWFQLTPGTVVIFDNWRVLHGRNAFK
GIRRICGAYINRDDWVSRWGNLNLTERENLYRVIG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggcgacatcgcagaccaaggccgcggttgcggcctcgatcgggctgcgggccttatct
tacgttttcctgagatggtcgttggtaccagtcctccctgccatcgtttttacccttttt
gcactttatctgcctgcctttgtcttgggctaccggaaagaacccaagcacgtgctcgtg
gatagagtagacgtggttgtcaccgagacgacggtggaaggtaaaggcacgccgaacaac
ggagacagcagacggagccatggcgacagggaggttgtggccgaggatgtcagtgtcaag
gagacgatttcggtcgaggacaggcctctgaacccctggaagacgctgctcaccggagct
ccgaacccgcggagcctggccttgtccctcgccacgcttctcctcaacgggctctgtgtc
ggtctggtcgccgaccgcctgttccgggaacgctcctataccgtcgacgacttgtctttc
gtgcgagtcggatacgtgtcggagaacgaggcgaagctgctgatccgagagcccgaccag
tccaagatgcccatcacggtcgaagtgcacatcaaggacccccagcctccgttcgacaac
ccgctgtggcagaacgccggcggggtgaggtggacggccgaagagaccgactacaccgcg
gtcgtgtccatcccgctgcggcactccaagaagcggacctacgagtggcgcacctccaac
aaccactcgggcgagttcaccgcccctcccccgatcggacacgcggaggagaccaactac
ggccccttcaccttcctgtcgacctcgtgcatcatcccgcgcttcccgtacaaccccctg
gaccacccgctctctatcccgggtctccggcacctcgccagggtcctgcccaccctcaat
gcccagttcatgctcttcctcggcgacttcatctacgccgacgtgccgcgttactgggac
aagtcggtgggctactaccgccagaagtaccgccaggtctacgcctccccggactggccg
gcggtcgggcagaacctcagctggatccacgcgctcgacgaccacgagatcttcaacgac
tggtccgcgaacctgacgggcgtctacacgtccgccatcgaccccttccaccactaccac
gcggccgccaacccgccgcgcgcccggcgggcctcggccttcgccgcgcgcgcgccgaac
gcgacctacttcgagttcacgcaggggccggccagcttcttcctgctcgacacgcgctcg
ttccggtcgagcaacacgctgctcccggccacggcgaccgacaagacgatgctcggggcc
gaccagctggccgacctgctcgcgtggctgcgccggccggagccgcgcggggtcaagtgg
aagatcgtggcctcgtccgtgcccttcaccaagaactggccggtcaacacgcgcgacacc
tggggcggcttcctcgccgagcgcgccgtcgtgctcgaggccatgtgggacgccgccagc
cgcggcctcggcgtcgtcgtcctctcgggcgaccgccacgagttcgccgccaccaagttc
ccgccccccgacggcgacccccgctggcccgagaccgccaccgtctgggagttctcggcc
agcccgctgaaccagttctactcccccttcccgacctaccgccagacggaccgtgatgat
gtcatggtcaagtacatctacaagggcaactccaagtttggggcgataacgatcgagaat
atggaaggtagcgaccaaagcagcctcaagtaccggctattcatcgacggggaggaggtg
tggaacacggtcgttctgtctccgccgccggccaaggttgacaggtctactggctcattt
tggggccggagcgtctatcgttgggacttcctccggcactacatgtattacgatcaccgc
gccgacaagcccatgcgggaatactggggagacgaaatccagatgaggcctccggaggtt
gattatgacgtggtcatggaggatgataatgacgaccatggcgtcgccctcttgaccgat
aagatcgcaagtaggacatacggcttctgcttcgtcagacacactccttacgaggacccg
gacgacacccggaagctgctcgagcgcatcgccttcatccggcagacacactacggcggc
ttctacgacttcaagcccgacctcgccatggccgacacggcctacaccaatcaggcactg
ccgccgcacaccgataccacctactttaccgaccccgcagggctgcaggccttccacatg
ctctcgcacgagcgcggcccggatggcgagaggccctacggcggagcgtcggtgctggtg
gacgggttcaaggcagcgcgggtcctccatgacgaagatcgggaagcgtacaatgtcctg
aagaaggtcagactgccgtggcacgcgagcggcaacaagggcatcaccatccggcccgac
gtcaactacccggtgttcgagacgcactcgtccttgggactgtatcggatccggtggaac
aacgatgacagaggagtggtcccctttgacaaggtccggcccgaggtgtggtacagggcg
gccgccaaatggaacgagatcatcaaccggccgcggctgcagtattggttccagctgacc
cccggcacggtagtcatctttgacaactggcgtgtcctccatggccgaaacgcgttcaag
ggtatcaggaggatctgcggagcatatatcaacagggacgattgggtctcccgatgggga
aacctcaacctcaccgagcgggagaatctctacagagtaattgggtag

DBGET integrated database retrieval system