KEGG   Myceliophthora thermophila: MYCTH_2139555Help
Entry
MYCTH_2139555     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtm  Myceliophthora thermophila
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(1969072..1970003,1970065..1970114,1970162..1970336,1970389..1970407))
Genome map
AA seq 391 aa AA seqDB search
MPEIAEIARVVHYLRLHLVGKKIKTATAVEDNNVFGKVGTTGAEVSRALTGKKVLSAGTQ
GKYFWLVLDQPPHPVMHFGMTGWIHIKGDRTAYTNYYKKMKPEEMDLWPPKYWKFHLITE
NPAVEVAFTDPRRFGRVRLVDCPGESIRKFSPLVENGTDPVVDTDVFTEDYLREKMRSRH
VPIKALILDQTIISGIGNWVGDEVLYQAKLHPEQYCDDFSDEQITRLYKSIRHVCQFAVD
KLGDSDQFPEDWLFHYRWEKGQKGGVGHLPSGEKLAFLTVGGRTSCYVPEIQKKSGRIVP
GVKEEPIESDLEKEKPKKVVRAKDAIAEDAMPKSKKRKAEKDEIPAKRSRATPKKSATSE
SQATKGEVAERIGSNVEHGRRRSSRLQRKTA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagattgcggagatcgctcgagtggtgcactacctgcggttgcacttggttggg
aagaaaatcaagaccgccactgcggtagaggataacaatgtttttggcaaagtcggaacg
acgggagcggaggtctccagggcactcaccggaaagaaagttctatcagcggggacacaa
ggcaaatacttctggcttgttctcgatcagccgcctcatcctgtgatgcattttggaatg
acaggctggatccacatcaaaggggatcgaaccgcatataccaactattacaagaagatg
aagccggaagaaatggatctctggcccccgaaatactggaagttccacctgataaccgag
aacccggcagttgaggttgccttcacagatccccgccgctttggccgtgtgcgcctcgtg
gattgcccgggcgagagcatcaggaagttctccccgctcgtagaaaacggcactgacccg
gtcgttgacaccgacgttttcactgaggactacctccgagaaaagatgcgctcgcgccat
gttccaatcaaggcgctcattcttgaccagaccatcatcagcgggatcggcaactgggta
ggcgacgaggtcctctaccaggcgaagctgcatccagaacaatactgcgatgactttagc
gatgagcagataacaaggctctacaaatccattcgtcatgtctgtcaatttgccgtcgac
aagctcggggattctgaccaatttcccgaggactggctgttccactaccgatgggaaaaa
ggtcagaaggggggagtgggccatttgcccagcggcgagaagctggcctttctcacagta
ggggggaggacaagctgctatgtgccggagatacaaaagaagagtggtcgcattgttccc
ggcgtcaaggaggaacccatcgagtctgacctggagaaggaaaaacccaagaaagttgtt
agggcaaaggacgcaattgcagaggacgctatgccgaaaagcaaaaagaggaaggcagaa
aaggacgagataccagcaaaaaggagcagagctacccccaagaagtctgcgacgagcgaa
tcgcaggccactaagggggaagttgcggaaaggataggcagcaatgtcgagcacggcagg
cggcggtcaagcaggctgcaaaggaaaaccgcgtga

DBGET integrated database retrieval system